Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.01
PubTator Score 1.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy 1.387 2.2e-05
Astrocytoma, Pilocytic 1.300 2.6e-03
cystic fibrosis 1.500 3.2e-03
glioblastoma 1.100 5.7e-03
group 3 medulloblastoma 2.300 2.9e-03
intraductal papillary-mucinous adenoma (... -1.200 5.0e-04
medulloblastoma, large-cell 1.300 2.4e-02
non-small cell lung cancer 1.275 5.3e-12
ovarian cancer 1.900 1.6e-03
pancreatic ductal adenocarcinoma liver m... -3.161 2.9e-04
ulcerative colitis -2.500 3.6e-06

Synonym

Accession Q96QD5 G5E941 Q8N602 Q8NCU9 Q9UGK5
Symbols TR2
dJ85M6.4

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MATVQEKAAALNLSALHSPAHRPPGFSVAQKPFGATYVWSSIINTLQTQVEVKKRRHRLKRHNDCFVGSE      1 - 70
AVDVIFSHLIQNKYFGDVDIPRAKVVRVCQALMDYKVFEAVPTKVFGKDKKPTFEDSSCSLYRFTTIPNQ     71 - 140
DSQLGKENKLYSPARYADALFKSSDIRSASLEDLWENLSLKPANSPHVNISATLSPQVINEVWQEETIGR    141 - 210
LLQLVDLPLLDSLLKQQEAVPKIPQPKRQSTMVNSSNYLDRGILKAYSDSQEDEWLSAAIDCLEYLPDQM    211 - 280
VVEISRSFPEQPDRTDLVKELLFDAIGRYYSSREPLLNHLSDVHNGIAELLVNGKTEIALEATQLLLKLL    281 - 350
DFQNREEFRRLLYFMAVAANPSEFKLQKESDNRMVVKRIFSKAIVDNKNLSKGKTDLLVLFLMDHQKDVF    351 - 420
KIPGTLHKIVSVKLMAIQNGRDPNRDAGYIYCQRIDQRDYSNNTEKTTKDELLNLLKTLDEDSKLSAKEK    421 - 490
KKLLGQFYKCHPDIFIEHFGD                                                     491 - 511
//

Text Mined References (6)

PMID Year Title