Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.21
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 5.2715693405648E-12
sonic hedgehog group medulloblastoma 1482 4.70518557761599E-8
ulcerative colitis 2087 3.56184376838762E-6
acute quadriplegic myopathy 1157 2.23953958305979E-5
pancreatic ductal adenocarcinoma liver metastasis 1795 2.88482699130665E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 4.98465691208437E-4
ovarian cancer 8492 0.00163717110124836
pilocytic astrocytoma 3086 0.00304844866661708
cystic fibrosis 1670 0.00318877808332386
glioblastoma 5572 0.0183211578241961
medulloblastoma, large-cell 6234 0.0241808563223504
Disease Target Count Z-score Confidence
Cryptorchidism 67 3.629 1.8
Azoospermia 89 3.433 1.7

Expression

Synonym

Accession Q96QD5 G5E941 Q8N602 Q8NCU9 Q9UGK5
Symbols TR2
dJ85M6.4

Gene

PANTHER Protein Class (1)

  Ortholog (12)

Gene RIF (2)

PMID Text
25952135 DEPDC7 hypomethylation in peripheral blood DNA may be associated with recent depressive symptomatology.
25541973 The study identified the DEP domain-containing protein DEPDC7 as cellular binding partner of CARMA2 and CARMA3 proteins.

AA Sequence

MATVQEKAAALNLSALHSPAHRPPGFSVAQKPFGATYVWSSIINTLQTQVEVKKRRHRLKRHNDCFVGSE      1 - 70
AVDVIFSHLIQNKYFGDVDIPRAKVVRVCQALMDYKVFEAVPTKVFGKDKKPTFEDSSCSLYRFTTIPNQ     71 - 140
DSQLGKENKLYSPARYADALFKSSDIRSASLEDLWENLSLKPANSPHVNISATLSPQVINEVWQEETIGR    141 - 210
LLQLVDLPLLDSLLKQQEAVPKIPQPKRQSTMVNSSNYLDRGILKAYSDSQEDEWLSAAIDCLEYLPDQM    211 - 280
VVEISRSFPEQPDRTDLVKELLFDAIGRYYSSREPLLNHLSDVHNGIAELLVNGKTEIALEATQLLLKLL    281 - 350
DFQNREEFRRLLYFMAVAANPSEFKLQKESDNRMVVKRIFSKAIVDNKNLSKGKTDLLVLFLMDHQKDVF    351 - 420
KIPGTLHKIVSVKLMAIQNGRDPNRDAGYIYCQRIDQRDYSNNTEKTTKDELLNLLKTLDEDSKLSAKEK    421 - 490
KKLLGQFYKCHPDIFIEHFGD                                                     491 - 511
//

Text Mined References (6)

PMID Year Title
25952135 2015 Further evidence of DEPDC7 DNA hypomethylation in depression: A study in adult twins.
25541973 2014 The Dishevelled, EGL-10 and pleckstrin (DEP) domain-containing protein DEPDC7 binds to CARMA2 and CARMA3 proteins, and regulates NF-?B activation.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10568747 1999 A 7.5 Mb sequence-ready PAC contig and gene expression map of human chromosome 11p13-p14.1.