Property Summary

NCBI Gene PubMed Count 31
PubMed Score 50.87
PubTator Score 55.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma 1.100 8.4e-03
atypical teratoid / rhabdoid tumor 1.400 1.7e-05
ependymoma 1.300 3.1e-03
glioblastoma 1.400 1.4e-07
group 3 medulloblastoma 1.300 1.1e-04
hepatocellular carcinoma 1.200 8.6e-05
lung cancer -1.200 3.2e-03
medulloblastoma, large-cell 1.700 1.6e-05
ovarian cancer 1.100 9.2e-04
primitive neuroectodermal tumor 1.200 2.1e-06
psoriasis -1.400 5.6e-03
tuberculosis -1.100 2.7e-05

Gene RIF (20)

AA Sequence

MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSPEILVKFIDVG      1 - 70
GYKLLNNWLTYSKTTNNIPLLQQILLTLQHLPLTVDHLKQNNTAKLVKQLSKSSEDEELRKLASVLVSDW     71 - 140
MAVIRSQSSTQPAEKDKKKRKDEGKSRTTLPERPLTEVKAETRAEEAPEKKREKPKSLRTTAPSHAKFRS    141 - 210
TGLELETPSLVPVKKNASTVVVSDKYNLKPIPLKRQSNVAAPGDATPPAEKKYKPLNTTPNATKEIKVKI    211 - 280
IPPQPMEGLGFLDALNSAPVPGIKIKKKKKVLSPTAAKPSPFEGKTSTEPSTAKPSSPEPAPPSEAMDAD    281 - 350
RPGTPVPPVEVPELMDTASLEPGALDAKPVESPGDPNQLTRKGRKRKSVTWPEEGKLREYFYFELDETER    351 - 420
VNVNKIKDFGEAAKREILSDRHAFETARRLSHDNMEEKVPWVCPRPLVLPSPLVTPGSNSQERYIQAERE    421 - 490
KGILQELFLNKESPHEPDPEPYEPIPPKLIPLDEECSMDETPYVETLEPGGSGGSPDGAGGSKLPPVLAN    491 - 560
LMGSMGAGKGPQGPGGGGINVQEILTSIMGSPNSHPSEELLKQPDYSDKIKQMLVPHGLLGPGPIANGFP    561 - 630
PGGPGGPKGMQHFPPGPGGPMPGPHGGPGGPVGPRLLGPPPPPRGGDPFWDGPGDPMRGGPMRGGPGPGP    631 - 700
GPYHRGRGGRGGNEPPPPPPPFRGARGGRSGGGPPNGRGGPGGGMVGGGGHRPHEGPGGGMGNSSGHRPH    701 - 770
EGPGGGMGSGHRPHEGPGGSMGGGGGHRPHEGPGGGISGGSGHRPHEGPGGGMGAGGGHRPHEGPGGSMG    771 - 840
GSGGHRPHEGPGHGGPHGHRPHDVPGHRGHDHRGPPPHEHRGHDGPGHGGGGHRGHDGGHSHGGDMSNRP    841 - 910
VCRHFMMKGNCRYENNCAFYHPGVNGPPLP                                            911 - 940
//

Text Mined References (41)

PMID Year Title