Property Summary

NCBI Gene PubMed Count 28
Grant Count 11
R01 Count 10
Funding $787,161.63
PubMed Score 48.27
PubTator Score 55.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
hepatocellular carcinoma 1.200 0.000
ependymoma 1.300 0.003
psoriasis -1.400 0.006
group 4 medulloblastoma 1.800 0.000
astrocytoma 1.300 0.001
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.400 0.000
medulloblastoma, large-cell 1.700 0.000
primitive neuroectodermal tumor 1.200 0.000
tuberculosis and treatment for 6 months -2.100 0.000
lung cancer -1.200 0.003
ovarian cancer 1.100 0.001

Gene RIF (19)

PMID Text
26188041 CA expression increases whilst endogeneous PPP1R10 (PNUTS) expression decreases in HIV-1 (NL4-3) infected MOLT-3 cells over time
26188041 CA expression increases whilst endogeneous PPP1R10 (PNUTS) expression decreases in HIV-1 (NL4-3) infected MOLT-3 cells over time
26188041 PPP1R10 (PNUTS) may downregulate HIV transcription by preventing the assembly of a functional P-TEFb complex (CCNT1-CDK9) (shown to affect HIV-1 transcription)
24591642 PNUTS inhibits the PP1-mediated dephosphorylation of critical substrates, especially retinoblastoma protein, by blocking their binding sites on PP1.
24462707 PNUTS was a valid target of miR-383 and was involved in the inhibition of gammaH2AX.
23117887 our studies reveal PNUTS as a novel PTEN regulator and a likely oncogene.
23110726 CA expression increases whilst endogeneous PPP1R10 (PNUTS) expression decreases in HIV-1 (NL4-3) infected MOLT-3 cells over time
20890310 PNUTS is identified as a new and integral component of the DNA damage response involved in DNA repair.
20516061 mammalian Wdr82 functions in a variety of cellular processes; PTW/PP1 phosphatase complex (PNUTS, Tox4, Wdr82, PP1) has a role in the regulation of chromatin structure during the transition from mitosis into interphase
20372802 stimulation of PP1 activity via siRNA mediated knockdown of its interacting protein PNUTS (Phosphatase Nuclear Targeting Subunit) leads to Rb dephosphorylation and apoptosis in cancer cells
More...

AA Sequence

MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSPEILVKFIDVG      1 - 70
GYKLLNNWLTYSKTTNNIPLLQQILLTLQHLPLTVDHLKQNNTAKLVKQLSKSSEDEELRKLASVLVSDW     71 - 140
MAVIRSQSSTQPAEKDKKKRKDEGKSRTTLPERPLTEVKAETRAEEAPEKKREKPKSLRTTAPSHAKFRS    141 - 210
TGLELETPSLVPVKKNASTVVVSDKYNLKPIPLKRQSNVAAPGDATPPAEKKYKPLNTTPNATKEIKVKI    211 - 280
IPPQPMEGLGFLDALNSAPVPGIKIKKKKKVLSPTAAKPSPFEGKTSTEPSTAKPSSPEPAPPSEAMDAD    281 - 350
RPGTPVPPVEVPELMDTASLEPGALDAKPVESPGDPNQLTRKGRKRKSVTWPEEGKLREYFYFELDETER    351 - 420
VNVNKIKDFGEAAKREILSDRHAFETARRLSHDNMEEKVPWVCPRPLVLPSPLVTPGSNSQERYIQAERE    421 - 490
KGILQELFLNKESPHEPDPEPYEPIPPKLIPLDEECSMDETPYVETLEPGGSGGSPDGAGGSKLPPVLAN    491 - 560
LMGSMGAGKGPQGPGGGGINVQEILTSIMGSPNSHPSEELLKQPDYSDKIKQMLVPHGLLGPGPIANGFP    561 - 630
PGGPGGPKGMQHFPPGPGGPMPGPHGGPGGPVGPRLLGPPPPPRGGDPFWDGPGDPMRGGPMRGGPGPGP    631 - 700
GPYHRGRGGRGGNEPPPPPPPFRGARGGRSGGGPPNGRGGPGGGMVGGGGHRPHEGPGGGMGNSSGHRPH    701 - 770
EGPGGGMGSGHRPHEGPGGSMGGGGGHRPHEGPGGGISGGSGHRPHEGPGGGMGAGGGHRPHEGPGGSMG    771 - 840
GSGGHRPHEGPGHGGPHGHRPHDVPGHRGHDHRGPPPHEHRGHDGPGHGGGGHRGHDGGHSHGGDMSNRP    841 - 910
VCRHFMMKGNCRYENNCAFYHPGVNGPPLP                                            911 - 940
//

Text Mined References (37)

PMID Year Title
24591642 2014 Understanding the antagonism of retinoblastoma protein dephosphorylation by PNUTS provides insights into the PP1 regulatory code.
24462707 2014 microRNA-383 impairs phosphorylation of H2AX by targeting PNUTS and inducing cell cycle arrest in testicular embryonal carcinoma cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23117887 2013 PNUTS functions as a proto-oncogene by sequestering PTEN.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...