Property Summary

NCBI Gene PubMed Count 121
Grant Count 44
R01 Count 24
Funding $3,968,340.76
PubMed Score 104.08
PubTator Score 156.65

Knowledge Summary

Patent

No data available

Expression

Gene RIF (106)

PMID Text
26846339 DLC-1 acts as a tumor suppressor gene in HCC by regulating the expression of RhoA/ROCK2/ moesin.
26514520 Low DLC-1 expression is associated with cancer.
26401016 Data suggest BCL2-like 1 protein (BCL2L1) and deleted in liver cancer 1 protein (DLC1) as potential druggable targets for specific subsets of gastric cancer (GC) cases.
26239822 Low expression of DLC1 is predictive of poor therapeutic efficiency of fluoropyrimidine and oxaliplatin as adjuvant chemotherapy in gastric cancer.
26166433 A phosphorylation-mediated molecular switch comprising DLC), TNS3, PTEN and PI3K controls the spatiotemporal activation of Rac1 and RhoA, thereby initiating directional cell migration induced by growth factors.
26095787 No significant association of DLC1 SNPs with the patients' prognosis was found.
25743845 Low DLC1 expression is associated with cancer.
25452387 The CDK5 kinase phosphorylates four serines in DLC1 located N-terminal to the Rho-GAP domain.
25448629 During early cell spreading, DLC1 is preferentially localized at the inner/mature adhesions whereas phosphorylated paxillin occupies the outer/nascent focal adhesions. In addition, DLC1 downregulates paxillin turnover
25425654 Cooperation of DLC1 and CDK6 affects breast cancer clinical outcome
More...

AA Sequence

MSVAIRKRSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVSLPDCCHGSEL      1 - 70
RDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLCLTDDKQVLNTQGQKTSGQHM     71 - 140
IQGAGSLEKALPIIQSNQVSSNSWGIAGETELALVKESGERKVTDSISKSLELCNEISLSEIKDAPKVNA    141 - 210
VDTLNVKDIAPEKQLLNSAVIAQQRRKPDPPKDENERSTCNVVQNEFLDTPCTNRGLPLLKTDFGSCLLQ    211 - 280
PPSCPNGMSAENGLEKSGFSQHQNKSPPKVKAEDGMQCLQLKETLATQEPTDNQVRLRKRKEIREDRDRA    281 - 350
RLDSMVLLIMKLDQLDQDIENALSTSSSPSGTPTNLRRHVPDLESGSESGADTISVNQTRVNLSSDTEST    351 - 420
DLPSSTPVANSGTKPKTTAIQGISEKEKAEIEAKEACDWLRATGFPQYAQLYEDFLFPIDISLVKREHDF    421 - 490
LDRDAIEALCRRLNTLNKCAVMKLEISPHRKRSDDSDEDEPCAISGKWTFQRDSKRWSRLEEFDVFSPKQ    491 - 560
DLVPGSPDDSHPKDGPSPGGTLMDLSERQEVSSVRSLSSTGSLPSHAPPSEDAATPRTNSVISVCSSSNL    561 - 630
AGNDDSFGSLPSPKELSSFSFSMKGHEKTAKSKTRSLLKRMESLKLKSSHHSKHKAPSKLGLIISGPILQ    631 - 700
EGMDEEKLKQLNCVEISALNGNRINVPMVRKRSVSNSTQTSSSSSQSETSSAVSTPSPVTRTRSLSACNK    701 - 770
RVGMYLEGFDPFNQSTFNNVVEQNFKNRESYPEDTVFYIPEDHKPGTFPKALTNGSFSPSGNNGSVNWRT    771 - 840
GSFHGPGHISLRRENSSDSPKELKRRNSSSSMSSRLSIYDNVPGSILYSSSGDLADLENEDIFPELDDIL    841 - 910
YHVKGMQRIVNQWSEKFSDEGDSDSALDSVSPCPSSPKQIHLDVDNDRTTPSDLDSTGNSLNEPEEPSEI    911 - 980
PERRDSGVGASLTRSNRHRLRWHSFQSSHRPSLNSVSLQINCQSVAQMNLLQKYSLLKLTALLEKYTPSN    981 - 1050
KHGFSWAVPKFMKRIKVPDYKDRSVFGVPLTVNVQRTGQPLPQSIQQAMRYLRNHCLDQVGLFRKSGVKS   1051 - 1120
RIQALRQMNEGAIDCVNYEGQSAYDVADMLKQYFRDLPEPLMTNKLSETFLQIYQYVPKDQRLQAIKAAI   1121 - 1190
MLLPDENREVLQTLLYFLSDVTAAVKENQMTPTNLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQ   1191 - 1260
KDLNENLAATQGLAHMIAECKKLFQVPEEMSRCRNSYTEQELKPLTLEALGHLGNDDSADYQHFLQDCVD   1261 - 1330
GLFKEVKEKFKGWVSYSTSEQAELSYKKVSEGPPLRLWRSVIEVPAVPEEILKRLLKEQHLWDVDLLDSK   1331 - 1400
VIEILDSQTEIYQYVQNSMAPHPARDYVVLRTWRTNLPKGACALLLTSVDHDRAPVVGVRVNVLLSRYLI   1401 - 1470
EPCGPGKSKLTYMCRVDLRGHMPEWYTKSFGHLCAAEVVKIRDSFSNQNTETKDTKSR               1471 - 1528
//

Publication (126)

PMID Year Title
26846339 2016 DLC-1 is an independent prognostic marker and potential therapeutic target in hepatocellular cancer.
26514520 2015 Clinicopathological Significance of DLC-1 Expression in Cancer: a Meta-Analysis.
26401016 2015 Genomic alterations in BCL2L1 and DLC1 contribute to drug sensitivity in gastric cancer.
26239822 2015 Low expression of DLC1 is predictive of poor therapeutic efficiency of fluoropyrimidine and oxaliplatin as adjuvant chemotherapy in gastric cancer.
26166433 2015 A phosphorylation switch controls the spatiotemporal activation of Rho GTPases in directional cell migration.
26095787 2015 Significance of genetic variants in DLC1 and their association with hepatocellular carcinoma.
25743845 2015 H2O2 inhibits proliferation and mediates suppression of migration via DLC1/RhoA signaling in cancer cells.
25452387 2014 CDK5 is a major regulator of the tumor suppressor DLC1.
25448629 2014 Concerted modulation of paxillin dynamics at focal adhesions by Deleted in Liver Cancer-1 and focal adhesion kinase during early cell spreading.
25425654 2014 Cooperation of DLC1 and CDK6 affects breast cancer clinical outcome.
More...