Property Summary

NCBI Gene PubMed Count 132
PubMed Score 106.66
PubTator Score 156.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.4
Kidney cancer 2613 0.0 0.9
Disease Target Count Z-score Confidence
Bipolar Disorder 666 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2499 3.666 1.8
Disease Target Count
Carcinoma of colon 32

Expression

  Differential Expression (28)

Disease log2 FC p
adrenocortical carcinoma 1.217 2.4e-02
astrocytic glioma -1.400 2.3e-02
atypical teratoid/rhabdoid tumor -1.400 1.3e-02
autosomal dominant Emery-Dreifuss muscul... 1.107 8.0e-03
breast carcinoma -1.200 2.2e-03
colon cancer -1.800 3.3e-02
ductal carcinoma in situ -1.800 3.1e-04
ependymoma -1.400 2.5e-02
fibroadenoma -1.100 4.6e-02
intraductal papillary-mucinous adenoma (... -2.400 6.9e-04
intraductal papillary-mucinous carcinoma... -2.000 3.6e-03
intraductal papillary-mucinous neoplasm ... -2.900 3.2e-03
invasive ductal carcinoma -2.600 1.3e-04
lung adenocarcinoma -2.900 1.4e-11
lung cancer -2.500 2.9e-05
malignant mesothelioma 1.100 1.5e-03
non-inflammatory breast cancer -1.100 3.9e-02
non-small cell lung cancer -2.870 2.8e-27
oligodendroglioma -1.400 2.0e-02
osteosarcoma -1.791 2.1e-02
ovarian cancer -1.900 6.1e-08
pancreatic cancer 1.100 2.4e-02
pancreatic ductal adenocarcinoma liver m... -1.292 6.6e-03
pediatric high grade glioma -1.100 4.5e-03
Pick disease 1.600 8.3e-06
psoriasis -1.500 7.1e-04
sonic hedgehog group medulloblastoma -1.400 4.7e-04
ulcerative colitis 1.400 1.9e-04

Protein-protein Interaction (3)

Gene RIF (117)

AA Sequence

MSVAIRKRSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVSLPDCCHGSEL      1 - 70
RDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLCLTDDKQVLNTQGQKTSGQHM     71 - 140
IQGAGSLEKALPIIQSNQVSSNSWGIAGETELALVKESGERKVTDSISKSLELCNEISLSEIKDAPKVNA    141 - 210
VDTLNVKDIAPEKQLLNSAVIAQQRRKPDPPKDENERSTCNVVQNEFLDTPCTNRGLPLLKTDFGSCLLQ    211 - 280
PPSCPNGMSAENGLEKSGFSQHQNKSPPKVKAEDGMQCLQLKETLATQEPTDNQVRLRKRKEIREDRDRA    281 - 350
RLDSMVLLIMKLDQLDQDIENALSTSSSPSGTPTNLRRHVPDLESGSESGADTISVNQTRVNLSSDTEST    351 - 420
DLPSSTPVANSGTKPKTTAIQGISEKEKAEIEAKEACDWLRATGFPQYAQLYEDFLFPIDISLVKREHDF    421 - 490
LDRDAIEALCRRLNTLNKCAVMKLEISPHRKRSDDSDEDEPCAISGKWTFQRDSKRWSRLEEFDVFSPKQ    491 - 560
DLVPGSPDDSHPKDGPSPGGTLMDLSERQEVSSVRSLSSTGSLPSHAPPSEDAATPRTNSVISVCSSSNL    561 - 630
AGNDDSFGSLPSPKELSSFSFSMKGHEKTAKSKTRSLLKRMESLKLKSSHHSKHKAPSKLGLIISGPILQ    631 - 700
EGMDEEKLKQLNCVEISALNGNRINVPMVRKRSVSNSTQTSSSSSQSETSSAVSTPSPVTRTRSLSACNK    701 - 770
RVGMYLEGFDPFNQSTFNNVVEQNFKNRESYPEDTVFYIPEDHKPGTFPKALTNGSFSPSGNNGSVNWRT    771 - 840
GSFHGPGHISLRRENSSDSPKELKRRNSSSSMSSRLSIYDNVPGSILYSSSGDLADLENEDIFPELDDIL    841 - 910
YHVKGMQRIVNQWSEKFSDEGDSDSALDSVSPCPSSPKQIHLDVDNDRTTPSDLDSTGNSLNEPEEPSEI    911 - 980
PERRDSGVGASLTRSNRHRLRWHSFQSSHRPSLNSVSLQINCQSVAQMNLLQKYSLLKLTALLEKYTPSN    981 - 1050
KHGFSWAVPKFMKRIKVPDYKDRSVFGVPLTVNVQRTGQPLPQSIQQAMRYLRNHCLDQVGLFRKSGVKS   1051 - 1120
RIQALRQMNEGAIDCVNYEGQSAYDVADMLKQYFRDLPEPLMTNKLSETFLQIYQYVPKDQRLQAIKAAI   1121 - 1190
MLLPDENREVLQTLLYFLSDVTAAVKENQMTPTNLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQ   1191 - 1260
KDLNENLAATQGLAHMIAECKKLFQVPEEMSRCRNSYTEQELKPLTLEALGHLGNDDSADYQHFLQDCVD   1261 - 1330
GLFKEVKEKFKGWVSYSTSEQAELSYKKVSEGPPLRLWRSVIEVPAVPEEILKRLLKEQHLWDVDLLDSK   1331 - 1400
VIEILDSQTEIYQYVQNSMAPHPARDYVVLRTWRTNLPKGACALLLTSVDHDRAPVVGVRVNVLLSRYLI   1401 - 1470
EPCGPGKSKLTYMCRVDLRGHMPEWYTKSFGHLCAAEVVKIRDSFSNQNTETKDTKSR               1471 - 1528
//

Text Mined References (137)

PMID Year Title