Property Summary

NCBI Gene PubMed Count 121
PubMed Score 104.08
PubTator Score 156.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
malignant mesothelioma 1.100 1.5e-03
astrocytic glioma -1.800 6.5e-03
ependymoma -1.400 2.5e-02
oligodendroglioma -1.400 2.0e-02
psoriasis -1.500 7.1e-04
osteosarcoma -1.791 2.1e-02
autosomal dominant Emery-Dreifuss muscul... 1.107 8.0e-03
adrenocortical carcinoma 1.217 2.4e-02
primary pancreatic ductal adenocarcinoma 1.861 1.5e-03
non-small cell lung cancer -3.055 1.0e-28
intraductal papillary-mucinous adenoma (... -2.400 6.9e-04
intraductal papillary-mucinous carcinoma... -2.200 1.6e-03
intraductal papillary-mucinous neoplasm ... -2.900 3.2e-03
lung cancer -4.100 5.0e-07
colon cancer -1.800 3.3e-02
breast carcinoma -1.600 4.4e-24
fibroadenoma -1.100 4.6e-02
pediatric high grade glioma -1.100 4.5e-03
atypical teratoid/rhabdoid tumor -1.400 1.3e-02
sonic hedgehog group medulloblastoma -1.900 5.5e-04
lung adenocarcinoma -2.900 1.4e-11
non-inflammatory breast cancer -1.100 3.9e-02
Pick disease 1.600 8.3e-06
ductal carcinoma in situ -1.800 3.1e-04
invasive ductal carcinoma -2.600 1.3e-04
ulcerative colitis 1.400 1.9e-04
ovarian cancer 2.200 3.7e-05
pancreatic cancer 1.700 3.3e-03

Gene RIF (106)

PMID Text
26846339 DLC-1 acts as a tumor suppressor gene in HCC by regulating the expression of RhoA/ROCK2/ moesin.
26514520 Low DLC-1 expression is associated with cancer.
26401016 Data suggest BCL2-like 1 protein (BCL2L1) and deleted in liver cancer 1 protein (DLC1) as potential druggable targets for specific subsets of gastric cancer (GC) cases.
26239822 Low expression of DLC1 is predictive of poor therapeutic efficiency of fluoropyrimidine and oxaliplatin as adjuvant chemotherapy in gastric cancer.
26166433 A phosphorylation-mediated molecular switch comprising DLC), TNS3, PTEN and PI3K controls the spatiotemporal activation of Rac1 and RhoA, thereby initiating directional cell migration induced by growth factors.
26095787 No significant association of DLC1 SNPs with the patients' prognosis was found.
25743845 Low DLC1 expression is associated with cancer.
25452387 The CDK5 kinase phosphorylates four serines in DLC1 located N-terminal to the Rho-GAP domain.
25448629 During early cell spreading, DLC1 is preferentially localized at the inner/mature adhesions whereas phosphorylated paxillin occupies the outer/nascent focal adhesions. In addition, DLC1 downregulates paxillin turnover
25425654 Cooperation of DLC1 and CDK6 affects breast cancer clinical outcome
24604602 DLC-1 inhibits cell growth and invasion in human colon cancer, functioning as a tumor-suppressor gene, possibly through the regulation of the Wnt/beta-catenin signaling pathway.
24590291 Evaluation of clinical breast tumor samples revealed that reduced DLC1 expression was linked to elevated PTHLH expression and organ-specific metastasis to bone.
24587289 DLC1 might act as a congenital heart disease-associated gene in addition to its role as a tumor suppressor in cancer.
24557030 Cox regression analysis determined that strong cytoplasmic and nuclear DLC1 expression was a favorable independent prognostic factor for all melanoma (HR, 0.61; 95% CI) and metastatic melanoma patients (HR, 0.42; 95% CI).
24553346 Our data identify DLC1 as a locus for durable transgene expression that does not incur features of insertional oncogenesis, thus expanding options for developing ex vivo cell therapy mediated by site-specific integration methods.
24519699 Evidence supports an anti-metastatic role for DLC1 in several human cancers.[Review]
24338004 Studies indicate that deleted in liver cancer-1 (DLC1) contributes to growth and migratory suppressive effects through GAP-dependent and GAP-independent mechanisms.
24329682 It is involved in proliferation and invasion of GBC cells and may serve as a potential therapeutic target.
24082123 DLC1 was ubiquitinated and degraded by cullin 4A-RING ubiquitin ligase (CRL4A) complex interaction with DDB1 and the FBXW5 substrate receptor.
23988121 The expression of DLC1 and PAI-1 were closely related with the metastasis and invasion of ovarian carcinoma, only the combination of DLC1 and PAI-1 could serve as an independent prognostic factor of ovarian carcinoma.
23908159 DLC-1 is negatively associated with nasopharyngeal carcinoma carcinogenesis, and promoter hypermethylation along with loss of heterozygosity, but not mutation, contributes to inactivation of DLC-1 in nasopharyngeal carcinoma.
23783552 Hypermethylation of DLC1 gene is associated with colon carcinogenesis.
23681804 DLC-1 methylation status was an independent prognostic factor for the overall survival rate of pancreatic ductal adenocarcinoma patients.
23625658 DLC1 plays a pivotal role in the development and progression of cutaneous squamous cell carcinoma.
23588806 DLC-1 inhibits the proliferation, migration and tumorigenicity of human nasopharyngeal carcinoma cells.
23511482 study establishes a novel regulatory mechanism for DLC1 RhoGAP activity via dimerization induced by protein kinase A signalling
23510351 DLC-1 protein expression was negatively associated with both overall survival and with distant metastasis-free survival, but not with disease-free survival.
23509688 analysis of DLC-1 epigenetic silencing in the mucosa-adenoma-carcinoma transformation process of colorectal cancer
23376848 Study demonstrates that DLC1 expression positively regulates E-cadherin and suppresses highly metastatic PCA cell invasion by modulating Rho pathway.
23079702 Downregulation of FAK gene expression or/and upregulation of DLC-1 gene expression can all inhibit the OVCAR-3 cell growth.
23010077 Several genes and biochemical activities collaborate with the inactivation of DLC1 to give rise to cell transformation in MEFs, and the identified genes are relevant to human tumors with low DLC1 expression.
22799310 The results showed that in breast cancer, DLC-1 gene expression was significantly lower than that in normal breast tissue and benign breast lesions.
22760257 Silencing FAK mRNA expression and DLC1 mRNA expression may markedly enhance caspase-3 and caspase-9 activities in ovarian cancer cells.
22693251 complex formation between the DLC1 START domain and CAV-1 contributes to DLC1 tumor suppression via a RhoGAP-independent mechanism, and suggest that DLC1 inactivation probably contributes to cancer progression.
22645138 The tumor suppressor DLC1 utilizes a novel binding site for tensin2 PTB domain interaction
22522847 Aberrant DLC1 methylation and PIK3CA mutations may have important roles in extramammary Paget's disease pathogenesis.
22473989 a new mechanism through which DLC1 exerts its strong oncosuppressive function by positively influencing adherens junctions stability
22307599 study links dynamic regulation of tensin family members by EGF to Rho-GAP through DLC1 and suggests that the tensin-DLC1-RhoA signaling axis plays an important role in tumorigenesis and cancer metastasis, and may be explored for cancer intervention
22139079 study provides evidence that MKL1/2 mediates cancerous transformation in DLC1-deficient hepatocellular and mammary carcinoma cells
22064653 DLC1 modulates the expression of PAI-1, which is a negative regulator for cell migration, in a GAP domain and EGFR-MEK-dependent manner and independent of PAI-1, the interaction of DLC1 with tensin members positively regulates cell migration.
22002576 Loss of DLC1 expression emerged as an important biomarker for predicting patients diagnosed with oral dysplasia at high risk of oral squamous cell carcinoma.
21969587 DLC1 forms a complex with two prooncogenic proteins, talin and the focal adhesion kinase (FAK). We identified an 8-aa sequence (residues 469-476) in DLC1 and designated it an LD-like motif, because it shares homology with the LD motifs of paxillin.
21868344 The abnormal expression of DLC1 and p-FAK might participate in the carcinogenesis, progression, and metastasis of breast cancer.
21455586 DLC1 induction participates in Ursodeoxycholic acid-induced suppression of hepatocellular carcinoma cell growth
21372205 Results suggest that a novel GAP-independent mechanism contributes to the tumor suppressive activity of DLC1, and highlight the importance and complexity of protein-protein interactions involving DLC1 in certain cancers.
21217778 identified a new isoform of DLC1 with tumor suppressive function. The differential expression of various DLC1 isoforms suggests interplay in modulating the complex activities of DLC1 during carcinogenesis
21130076 These data indicated that the intracellular stability of DLC1 is regulated by the 26S proteasome via its PEST motifs.
21087603 PKD-mediated phosphorylation of DLC1 on serine 807 negatively regulates DLC1 cellular function
20974048 The DLC1 gene is methylated in the majority of chronic lymphocytic leukaemia patients.
20967756 We present several lines of evidence that efficient HCV replication requires miR-141-mediated suppression of DLC-1.
20882354 DLC-1 may play an important role in lymphoma by acting as a bona fide new tumor suppressor gene.
20634475 The p122 protein is upregulated in patients with coronary spasm, causing increased [Ca(2+)](i) to acetylcholine, and thereby seems to be related to enhanced coronary vasomotility.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20600027 Phosphorylation of DLC1 and DLC2 by protein kinase B at the conserved residue points to a common regulatory mechanism of the DLC tumor suppressor family.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198346 Report effects of adenoviral (Ad)-DLC1-mediated transduction and exposure to suberoylanilide hydroxamic acid on prostate/hepatocellular carcinoma cells.
20083228 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20069572 focal adhesion-localized tensin 2 negatively regulates DLC1 to permit Rho-mediated actomyosin contraction and remodeling of collagen fibers
19913121 Observational study of gene-disease association. (HuGE Navigator)
19911011 Observational study of gene-disease association. (HuGE Navigator)
19895840 Data suggest that the interaction between START-GAP1 and tensin2 occurs in a PTB domain-dependent manner.
19874489 DLC1 isoforms are differentially expressed in human tissues, have different epigenetic transcriptional regulations and are functionally different.
19826001 Results suggest that PP1alpha bound to tensin1 has effects in reducing migration and invasion that are not mediated through DLC-1, and show the importance of PP1alpha binding to tensin1 for the regulation of cell polarization, migration, and invasion.
19795399 Observational study of gene-disease association. (HuGE Navigator)
19766077 Our findings suggest that DLC1 genetic polymorphism or haplotype play a role in mediating the susceptibility to hepatitis B virus-related hepatocellular carcinoma
19766077 Observational study of gene-disease association. (HuGE Navigator)
19710422 DLC1 binds to phosphatidylinositol-4,5-bisphosphate through a previously unrecognized polybasic region adjacent to its RhoGAP domain. PI(4,5)P(2)-containing membranes are shown to stimulate DLC1 GAP activity in vitro.
19667410 Results confirm the role of DLC1 gene as a tumor suppressor, which may be manifested by regulation of p21 and cyclinDl.
19482022 Results suggest that the concerted local inactivation of signaling pathways downstream of PTEN and DLC1, respectively, is required for the tight control of cell migration.
19440389 In addition to properly localizing focal adhesions and preserving RhoGAP activity, DLC1 interaction with tensin2 through this novel focal adhesion binding site contributes to the growth-suppressive activity of DLC1.
19380190 DLC-1 plays a crucial role in signal transduction pathway regulating the cell proliferation, migration, and carcinogenesis of human renal cell carcinoma
19240061 Observational study of gene-disease association. (HuGE Navigator)
19221866 DLC-1 is a tumor suppressor protein with RhoGAP activity and roles in regulation of the cytoskeleton and cell motility [review]
19170769 Focal adhesion-localization of START-GAP1/DLC1 is essential for cell motility and morphology.
19158340 This finding reveals a novel contribution of the SAM-EF1A1 interaction as a potentially important GAP-independent modulation of cell migration by DLC1.
19151751 p120Ras-GAP binds the DLC1 Rho-GAP tumor suppressor protein and inhibits its RhoA GTPase and growth-suppressing activities.
19116449 These results demonstrated the requirement of specific Sp1 sites and dependence of Sp1 and p300 for TSA-mediated activation of DLC-1 promoter.
19066281 Results show that phorbol-ester-induced activation of protein kinases C and D stimulates association of DLC1 with 14-3-3 adaptor proteins, inhibiting RhoGAP activity and blocking nucleocytoplasmic transfer.
18981889 The results suggest that DLC1 may function as a tumor suppressor gene in meningiomas. Furthermore, DLC1 promoter methylation does not appear to be responsible for the decreased DLC1 expression in these tumors.
18974116 data show that DLC1 is critically involved in the control of Rho signaling and actin cytoskeleton remodeling and that its cellular loss is sufficient for the acquisition of a more migratory phenotype of breast cancer cells
18923442 antiproliferative effect of DLC1 in a hematological cancer
18829524 Mutations in DLC-1 may lead to loss of function and contribute to the tumorigenesis, and have revealed an allosteric regulation site for its RhoGAP activity.
18786931 expression of the amino-terminal domain of DLC-1 acts as a dominant negative and profoundly inhibits cell migration by displacing endogenous DLC-1 from focal adhesions
18648664 DLC1 negatively regulates Rho/ROCK/MLC2
18627284 DLC1 polymorphism is not associated with nasopharynmgeal neoplasm risk in Chinese population.
18627284 Observational study of gene-disease association. (HuGE Navigator)
18288400 Results suggest that the DLC-1 gene is associated with cell proliferation, migration and cell cycle distribution in a colon cancer cell line.
17965626 DLC1 methylation is a frequent event in multiple lymphomagenesis and could serve as a tumor-specific biomarker for future lymphoma diagnosis.
17932950 Down regulation of DLC1 is associated with non-small cell lung cancer
17888903 These analyses provide evidence for a possible link between morphological alterations, protein nuclear translocation and proapoptotic and anti-oncogenic activities of DLC1 in lung cancer.
17292327 Involved in signal transduction pathway regulating cell proliferation, cell morphology, and cell migration in liver cancers.
17190795 These results provide a novel mechanism whereby the SH2 domain of cten-mediated focal adhesion localization of DLC-1 plays an essential role in its tumor suppression activity.
16951145 DLC1 and tensin2 complex interacts with Rho GTPases in caveolae to effect cytoskeletal reorganization.
16862168 DLC1 appears to be a major tumor suppressor genes implicated in the pathogenesis of these tumors
16774933 Down-regulation of DLC1 is associated with non-Hodgkin's lymphoma
16680376 Taken together, our results suggest that DLC-1 might be an NPC-related tumor suppressor gene affected by aberrant promoter methylation and gene deletion.
16533763 Loss of DCL-1 is associated with prostate carcinomas
15201975 Hypermethylation is responsible for silencing of DLC-1 gene in a limited portion of breast cancers.
14661059 DLC-1 plays a role in non-small cell lung carcinoma by acting as a bona fide new tumor suppressor gene.
14647417 Dlc-1 protein is involved in hepatocarcinogenesis and has oncosuppressive activity in Hepatocellular carcinoma.
14633684 Transcriptional silencing by hypermethylation may contribute to the inactivation of the DLC-1 gene in hepatocellular carcinoma.
12873722 Observational study of gene-disease association. (HuGE Navigator)
12813468 Methylation of the DLC-1 CpG island is not uncommon in gastric cancer. The transcriptional silencing of DLC-1, by epigenetic mechanism, may be involved in gastric carcinogenesis.
12792785 genomic deletion and promoter methylation primarily account for the altered expression and tumor suppressive inactivation of the DLC-1 gene
12645648 Differences in promoter hypermethylation were seen in 12 hepatocellular carcinoma, breast, colon, and prostate tumor cell lines with aberrant DLC-1 expression. Hypermethylation abrogates the function of the DLC-1 gene in a subset of these cancers.
12545165 Genomic deletion of DLC-1 was observed in 40% of breast tumors, whereas reduced levels of DLC-1 mRNA were seen in 70% of breast, 70% of colon, 50% of prostate tumor cell lines.DLC-1 gene plays a role in breast cancer by acting as a tumor suppressor gene

AA Sequence

MSVAIRKRSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVSLPDCCHGSEL      1 - 70
RDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLCLTDDKQVLNTQGQKTSGQHM     71 - 140
IQGAGSLEKALPIIQSNQVSSNSWGIAGETELALVKESGERKVTDSISKSLELCNEISLSEIKDAPKVNA    141 - 210
VDTLNVKDIAPEKQLLNSAVIAQQRRKPDPPKDENERSTCNVVQNEFLDTPCTNRGLPLLKTDFGSCLLQ    211 - 280
PPSCPNGMSAENGLEKSGFSQHQNKSPPKVKAEDGMQCLQLKETLATQEPTDNQVRLRKRKEIREDRDRA    281 - 350
RLDSMVLLIMKLDQLDQDIENALSTSSSPSGTPTNLRRHVPDLESGSESGADTISVNQTRVNLSSDTEST    351 - 420
DLPSSTPVANSGTKPKTTAIQGISEKEKAEIEAKEACDWLRATGFPQYAQLYEDFLFPIDISLVKREHDF    421 - 490
LDRDAIEALCRRLNTLNKCAVMKLEISPHRKRSDDSDEDEPCAISGKWTFQRDSKRWSRLEEFDVFSPKQ    491 - 560
DLVPGSPDDSHPKDGPSPGGTLMDLSERQEVSSVRSLSSTGSLPSHAPPSEDAATPRTNSVISVCSSSNL    561 - 630
AGNDDSFGSLPSPKELSSFSFSMKGHEKTAKSKTRSLLKRMESLKLKSSHHSKHKAPSKLGLIISGPILQ    631 - 700
EGMDEEKLKQLNCVEISALNGNRINVPMVRKRSVSNSTQTSSSSSQSETSSAVSTPSPVTRTRSLSACNK    701 - 770
RVGMYLEGFDPFNQSTFNNVVEQNFKNRESYPEDTVFYIPEDHKPGTFPKALTNGSFSPSGNNGSVNWRT    771 - 840
GSFHGPGHISLRRENSSDSPKELKRRNSSSSMSSRLSIYDNVPGSILYSSSGDLADLENEDIFPELDDIL    841 - 910
YHVKGMQRIVNQWSEKFSDEGDSDSALDSVSPCPSSPKQIHLDVDNDRTTPSDLDSTGNSLNEPEEPSEI    911 - 980
PERRDSGVGASLTRSNRHRLRWHSFQSSHRPSLNSVSLQINCQSVAQMNLLQKYSLLKLTALLEKYTPSN    981 - 1050
KHGFSWAVPKFMKRIKVPDYKDRSVFGVPLTVNVQRTGQPLPQSIQQAMRYLRNHCLDQVGLFRKSGVKS   1051 - 1120
RIQALRQMNEGAIDCVNYEGQSAYDVADMLKQYFRDLPEPLMTNKLSETFLQIYQYVPKDQRLQAIKAAI   1121 - 1190
MLLPDENREVLQTLLYFLSDVTAAVKENQMTPTNLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQ   1191 - 1260
KDLNENLAATQGLAHMIAECKKLFQVPEEMSRCRNSYTEQELKPLTLEALGHLGNDDSADYQHFLQDCVD   1261 - 1330
GLFKEVKEKFKGWVSYSTSEQAELSYKKVSEGPPLRLWRSVIEVPAVPEEILKRLLKEQHLWDVDLLDSK   1331 - 1400
VIEILDSQTEIYQYVQNSMAPHPARDYVVLRTWRTNLPKGACALLLTSVDHDRAPVVGVRVNVLLSRYLI   1401 - 1470
EPCGPGKSKLTYMCRVDLRGHMPEWYTKSFGHLCAAEVVKIRDSFSNQNTETKDTKSR               1471 - 1528
//

Text Mined References (126)

PMID Year Title
26846339 2016 DLC-1 is an independent prognostic marker and potential therapeutic target in hepatocellular cancer.
26514520 2015 Clinicopathological Significance of DLC-1 Expression in Cancer: a Meta-Analysis.
26401016 2015 Genomic alterations in BCL2L1 and DLC1 contribute to drug sensitivity in gastric cancer.
26239822 2015 Low expression of DLC1 is predictive of poor therapeutic efficiency of fluoropyrimidine and oxaliplatin as adjuvant chemotherapy in gastric cancer.
26166433 2015 A phosphorylation switch controls the spatiotemporal activation of Rho GTPases in directional cell migration.
26095787 2015 Significance of genetic variants in DLC1 and their association with hepatocellular carcinoma.
25743845 2015 H2O2 inhibits proliferation and mediates suppression of migration via DLC1/RhoA signaling in cancer cells.
25452387 2014 CDK5 is a major regulator of the tumor suppressor DLC1.
25448629 2014 Concerted modulation of paxillin dynamics at focal adhesions by Deleted in Liver Cancer-1 and focal adhesion kinase during early cell spreading.
25425654 2014 Cooperation of DLC1 and CDK6 affects breast cancer clinical outcome.
24604602 2014 Tumor suppressor DLC-1 induces apoptosis and inhibits the growth and invasion of colon cancer cells through the Wnt/?-catenin signaling pathway.
24590291 2014 DLC1-dependent parathyroid hormone-like hormone inhibition suppresses breast cancer bone metastasis.
24587289 2014 Uncovering the rare variants of DLC1 isoform 1 and their functional effects in a Chinese sporadic congenital heart disease cohort.
24557030 2014 DLC1 expression is reduced in human cutaneous melanoma and correlates with patient survival.
24553346 2014 Intragenic integration in DLC1 sustains factor VIII expression in primary human cells without insertional oncogenicity.
24519699 2014 Deleted in liver cancer-1 (DLC1): an emerging metastasis suppressor gene.
24412244 2014 Charting the molecular links between driver and susceptibility genes in colorectal cancer.
24338004 2014 GAP-independent functions of DLC1 in metastasis.
24329682 2014 Inhibitory effects of deleted in liver cancer 1 gene on gallbladder cancer growth through induction of cell cycle arrest and apoptosis.
24315451 2014 Fraction of exhaled nitric oxide values in childhood are associated with 17q11.2-q12 and 17q12-q21 variants.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24082123 2013 CRL4A-FBXW5-mediated degradation of DLC1 Rho GTPase-activating protein tumor suppressor promotes non-small cell lung cancer cell growth.
23988121 2013 Expression of deleted in liver cancer 1 and plasminogen activator inhibitor 1 protein in ovarian carcinoma and their clinical significance.
23908159 2014 Promoter hypermethylation along with LOH, but not mutation, contributes to inactivation of DLC-1 in nasopharyngeal carcinoma.
23783552 2013 Promoter methylation of the DLC?1 gene and its inhibitory effect on human colon cancer.
23681804 2013 DLC-1 is a candidate biomarker methylated and down-regulated in pancreatic ductal adenocarcinoma.
23625658 2013 DLC1 as a regulator of proliferation, invasion, cell cycle, and apoptosis in cutaneous squamous cell carcinoma.
23588806 2013 DLC-1, a candidate tumor suppressor gene, inhibits the proliferation, migration and tumorigenicity of human nasopharyngeal carcinoma cells.
23511482 2013 PKA-induced dimerization of the RhoGAP DLC1 promotes its inhibition of tumorigenesis and metastasis.
23510351 2013 Aberrant deleted in liver cancer-1 expression is associated with tumor metastasis and poor prognosis in urothelial carcinoma.
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
23509688 2013 Downregulation of DLC-1 gene by promoter methylation during primary colorectal cancer progression.
23376848 2014 DLC1 induces expression of E-cadherin in prostate cancer cells through Rho pathway and suppresses invasion.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23079702 2012 Effect of FAK, DLC-1 gene expression on OVCAR-3 proliferation.
23010077 2012 Inactivation of the Dlc1 gene cooperates with downregulation of p15INK4b and p16Ink4a, leading to neoplastic transformation and poor prognosis in human cancer.
22799310 2012 DLC-1 expression levels in breast cancer assessed by qRT- PCR are negatively associated with malignancy.
22760257 2012 Effect of small interfering RNA transfection on FAK and DLC1 mRNA expression in OVCAR-3.
22693251 2012 Functional interaction of tumor suppressor DLC1 and caveolin-1 in cancer cells.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
22645138 2012 Solution structure of the phosphotyrosine binding (PTB) domain of human tensin2 protein in complex with deleted in liver cancer 1 (DLC1) peptide reveals a novel peptide binding mode.
22522847 2012 Correlation of DLC1 gene methylation with oncogenic PIK3CA mutations in extramammary Paget's disease.
22473989 2012 DLC1 interaction with ?-catenin stabilizes adherens junctions and enhances DLC1 antioncogenic activity.
22307599 2012 Differential regulation of the activity of deleted in liver cancer 1 (DLC1) by tensins controls cell migration and transformation.
22139079 2012 The transcriptional coactivators megakaryoblastic leukemia 1/2 mediate the effects of loss of the tumor suppressor deleted in liver cancer 1.
22064653 2012 Silencing of DLC1 upregulates PAI-1 expression and reduces migration in normal prostate cells.
22002576 2012 Loss of DLC1 is an independent prognostic factor in patients with oral squamous cell carcinoma.
21969587 2011 Full activity of the deleted in liver cancer 1 (DLC1) tumor suppressor depends on an LD-like motif that binds talin and focal adhesion kinase (FAK).
21868344 2011 [Expression of deleted in liver cancer 1 and phosphorelated focal adhesion kinase in breast cancer].
21455586 2011 Ursodeoxycholic acid-induced inhibition of DLC1 protein degradation leads to suppression of hepatocellular carcinoma cell growth.
21372205 2011 DLC1 interaction with S100A10 mediates inhibition of in vitro cell invasion and tumorigenicity of lung cancer cells through a RhoGAP-independent mechanism.
21217778 2011 A novel isoform of the 8p22 tumor suppressor gene DLC1 suppresses tumor growth and is frequently silenced in multiple common tumors.
21130076 2011 The intracellular stability of DLC1 is regulated by the 26S proteasome in human hepatocellular carcinoma cell line Hep3B.
21087603 2011 The tumor suppressor protein DLC1 is regulated by PKD-mediated GAP domain phosphorylation.
20974048 2010 Advanced rai stage in patients with chronic lymphocytic leukaemia correlates with simultaneous hypermethylation of plural tumour suppressor genes.
20967756 2011 MicroRNA silencing of tumor suppressor DLC-1 promotes efficient hepatitis C virus replication in primary human hepatocytes.
20882354 2011 DLC-1 as a modulator of proliferation, apoptosis and migration in Burkitt's lymphoma cells.
20634475 2010 p122 protein enhances intracellular calcium increase to acetylcholine: its possible role in the pathogenesis of coronary spastic angina.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20600027 2010 Akt phosphorylation of deleted in liver cancer 1 abrogates its suppression of liver cancer tumorigenesis and metastasis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20198346 2010 Synergistic antineoplastic effect of DLC1 tumor suppressor protein and histone deacetylase inhibitor, suberoylanilide hydroxamic acid (SAHA), on prostate and liver cancer cells: perspectives for therapeutics.
20083228 2010 Genome-wide analysis of chromosomal alterations in patients with esophageal squamous cell carcinoma exposed to tobacco and betel quid from high-risk area in India.
20069572 2010 Tensin 2 modulates cell contractility in 3D collagen gels through the RhoGAP DLC1.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
19895840 2010 START-GAP1/DLC1 is localized in focal adhesions through interaction with the PTB domain of tensin2.
19874489 2010 Deleted in liver cancer 1 isoforms are distinctly expressed in human tissues, functionally different and under differential transcriptional regulation in hepatocellular carcinoma.
19826001 2009 Tensin1 requires protein phosphatase-1alpha in addition to RhoGAP DLC-1 to control cell polarization, migration, and invasion.
19795399 2009 Genome-wide linkage scans for type 2 diabetes mellitus in four ethnically diverse populations-significant evidence for linkage on chromosome 4q in African Americans: the Family Investigation of Nephropathy and Diabetes Research Group.
19766077 2009 Association of DLC1 gene polymorphism with susceptibility to hepatocellular carcinoma in Chinese hepatitis B virus carriers.
19732724 2009 The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis.
19710422 2009 DLC1 activation requires lipid interaction through a polybasic region preceding the RhoGAP domain.
19667410 2009 Restoration of DLC1 gene inhibits proliferation and migration of human colon cancer HT29 cells.
19482022 2009 Simultaneous loss of the DLC1 and PTEN tumor suppressors enhances breast cancer cell migration.
19440389 2009 Deleted in liver cancer 1 (DLC1) utilizes a novel binding site for Tensin2 PTB domain interaction and is required for tumor-suppressive function.
19380190 2009 Overexpression of DLC-1 induces cell apoptosis and proliferation inhibition in the renal cell carcinoma.
19317456 2009 Characterization of DLC1-SAM equilibrium unfolding at the amino acid residue level.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19221866 2009 Role of DLC-1, a tumor suppressor protein with RhoGAP activity, in regulation of the cytoskeleton and cell motility.
19170769 2009 Focal adhesion-localization of START-GAP1/DLC1 is essential for cell motility and morphology.
19158340 2009 The SAM domain of the RhoGAP DLC1 binds EF1A1 to regulate cell migration.
19151751 2009 p120Ras-GAP binds the DLC1 Rho-GAP tumor suppressor protein and inhibits its RhoA GTPase and growth-suppressing activities.
19116449 2008 Transcriptional induction of DLC-1 gene through Sp1 sites by histone deacetylase inhibitors in gastric cancer cells.
19066281 2009 DLC1 interacts with 14-3-3 proteins to inhibit RhoGAP activity and block nucleocytoplasmic shuttling.
18981889 2008 Identification of the deleted in liver cancer 1 gene, DLC1, as a candidate meningioma tumor suppressor.
18974116 2008 Deleted in liver cancer 1 controls cell migration through a Dia1-dependent signaling pathway.
18923442 2009 DLC1 tumor suppressor gene inhibits migration and invasion of multiple myeloma cells through RhoA GTPase pathway.
18829524 2008 Mutations in the focal adhesion targeting region of deleted in liver cancer-1 attenuate their expression and function.
18786931 2008 Effects of structure of Rho GTPase-activating protein DLC-1 on cell morphology and migration.
18648664 2008 Deleted in liver cancer 1 (DLC1) negatively regulates Rho/ROCK/MLC pathway in hepatocellular carcinoma.
18627284 2008 The DLC-1 -29A/T polymorphism is not associated with nasopharyngeal carcinoma risk in Chinese population.
18288400 2008 Inhibition of DLC-1 gene expression by RNA interference in the colon cancer LoVo cell line.
17979893 DLC-1:a Rho GTPase-activating protein and tumour suppressor.
17965626 Tumor-specific methylation of the 8p22 tumor suppressor gene DLC1 is an epigenetic biomarker for Hodgkin, nasal NK/T-cell and other types of lymphomas.
17932950 2008 DLC-1 suppresses non-small cell lung cancer growth and invasion by RhoGAP-dependent and independent mechanisms.
17888903 2007 Morphological changes and nuclear translocation of DLC1 tumor suppressor protein precede apoptosis in human non-small cell lung carcinoma cells.
17292327 2007 DLC-1, a GTPase-activating protein for Rho, is associated with cell proliferation, morphology, and migration in human hepatocellular carcinoma.
17190795 2007 The phosphotyrosine-independent interaction of DLC-1 and the SH2 domain of cten regulates focal adhesion localization and growth suppression activity of DLC-1.
16951145 2006 Interaction of deleted in liver cancer 1 with tensin2 in caveolae and implications in tumor suppression.
16862168 2007 The major 8p22 tumor suppressor DLC1 is frequently silenced by methylation in both endemic and sporadic nasopharyngeal, esophageal, and cervical carcinomas, and inhibits tumor cell colony formation.
16774933 2007 Discovery of novel epigenetic markers in non-Hodgkin's lymphoma.
16680376 2006 Genetic and epigenetic alterations of DLC-1, a candidate tumor suppressor gene, in nasopharyngeal carcinoma.
16533763 2006 Aberrant methylation and deacetylation of deleted in liver cancer-1 gene in prostate cancer: potential clinical applications.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15201975 2004 Less frequent promoter hypermethylation of DLC-1 gene in primary breast cancers.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14661059 2004 DLC-1 operates as a tumor suppressor gene in human non-small cell lung carcinomas.
14647417 2004 Restoration of DLC-1 gene expression induces apoptosis and inhibits both cell growth and tumorigenicity in human hepatocellular carcinoma cells.
14633684 2003 Genetic and epigenetic alterations of DLC-1 gene in hepatocellular carcinoma.
12873722 2003 Evaluation of DLC1 as a prostate cancer susceptibility gene: mutation screen and association study.
12813468 2003 Transcriptional silencing of the DLC-1 tumor suppressor gene by epigenetic mechanism in gastric cancer cells.
12792785 2003 DNA variants of DLC-1, a candidate tumor suppressor gene in human hepatocellular carcinoma.
12645648 2003 Promoter hypermethylation of DLC-1, a candidate tumor suppressor gene, in several common human cancers.
12545165 2003 DLC-1 gene inhibits human breast cancer cell growth and in vivo tumorigenicity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10844022 2000 Interaction of the postsynaptic density-95/guanylate kinase domain-associated protein complex with a light chain of myosin-V and dynein.
10702663 1999 Assignment and cloning of mouse Arhgap7 to chromosome 8A4-B2, a conserved syntenic region of human chromosome 8p22-->p21.
10649492 2000 Sequence variants of DLC1 in colorectal and ovarian tumours.
9605766 1998 Cloning, characterization, and chromosomal localization of a gene frequently deleted in human liver cancer (DLC-1) homologous to rat RhoGAP.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.