Property Summary

NCBI Gene PubMed Count 24
Grant Count 19
R01 Count 18
Funding $1,138,047.26
PubMed Score 25.04
PubTator Score 31.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.226 0.000
group 3 medulloblastoma 1.200 0.001

Gene RIF (13)

PMID Text
26035443 Results show that PCA1 expression was positively correlated with advanced stages in renal cell carcinoma and strongly suggest that PCA-1 may be functionally important and a novel molecular target for human renal cell carcinoma.
25797601 It was shown for first time that DNA glycosylase ALKBH3 can repair DNA adduct 3,N4-ethenocytosine from single-stranded DNA.
22850567 ALKBH3 contributes to development of urothelial carcinomas by accelerating their survival, angiogenesis, and invasion
22826605 Our results establish PCA-1/ALKBH3 as important gene in pancreatic cancer
22515525 ALKBH3 gene silencing markedly induces apoptosis in hormone-independent prostate cancer cell line DU145.
22055184 DNA unwinding by ASCC3 helicase is coupled to ALKBH3-dependent DNA alkylation repair and cancer cell proliferation.
21285982 ALKBH3 contributes significantly to cancer cell survival and may be a therapeutic target for human adenocarcinoma of the lung.
20970119 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20714506 This work has provided a detailed understanding of the structural features of the single-stranded DNA and double-stranded DNA preferences of ABH2 and ABH3.
20525795 Divergent sequences outside of the active site determine substrate specificities of ABH3.
More...

AA Sequence

MEEKRRRARVQGAWAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLSDREFVFKEPQQVVRRAPEPR      1 - 70
VIDREGVYEISLSPTGVSRVCLYPGFVDVKEADWILEQLCQDVPWKQRTGIREDITYQQPRLTAWYGELP     71 - 140
YTYSRITMEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFG    141 - 210
ATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPD    211 - 280
PRGAPW                                                                    281 - 286
//

Text Mined References (26)

PMID Year Title
26863410 2016 Transcriptome-wide mapping reveals reversible and dynamic N(1)-methyladenosine methylome.
26863196 2016 The dynamic N(1)-methyladenosine methylome in eukaryotic messenger RNA.
26035443 2015 Clinical significance and therapeutic potential of prostate cancer antigen-1/ALKBH3 in human renal cell carcinoma.
25797601 2015 Differential repair of etheno-DNA adducts by bacterial and human AlkB proteins.
25416956 2014 A proteome-scale map of the human interactome network.
22850567 2012 ALKBH3 contributes to survival and angiogenesis of human urothelial carcinoma cells through NADPH oxidase and tweak/Fn14/VEGF signals.
22826605 2012 PCA-1/ALKBH3 contributes to pancreatic cancer by supporting apoptotic resistance and angiogenesis.
22515525 2012 anti-tumor effect of AlkB homolog 3 knockdown in hormone- independent prostate cancer cells.
22055184 2011 DNA unwinding by ASCC3 helicase is coupled to ALKBH3-dependent DNA alkylation repair and cancer cell proliferation.
21285982 2011 ALKBH3, a human AlkB homologue, contributes to cell survival in human non-small-cell lung cancer.
More...