Property Summary

NCBI Gene PubMed Count 24
PubMed Score 25.04
PubTator Score 31.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 2.68506256032761E-4
group 3 medulloblastoma 2254 6.84049912326701E-4

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.226 0.000
group 3 medulloblastoma 1.200 0.001

Synonym

Accession Q96Q83 A6NDJ1 Q3SYI0 Q6NX57 Q96BU8
Symbols ABH3
PCA1
DEPC1
hABH3
DEPC-1

Gene

PDB

2IUW  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (13)

PMID Text
26035443 Results show that PCA1 expression was positively correlated with advanced stages in renal cell carcinoma and strongly suggest that PCA-1 may be functionally important and a novel molecular target for human renal cell carcinoma.
25797601 It was shown for first time that DNA glycosylase ALKBH3 can repair DNA adduct 3,N4-ethenocytosine from single-stranded DNA.
22850567 ALKBH3 contributes to development of urothelial carcinomas by accelerating their survival, angiogenesis, and invasion
22826605 Our results establish PCA-1/ALKBH3 as important gene in pancreatic cancer
22515525 ALKBH3 gene silencing markedly induces apoptosis in hormone-independent prostate cancer cell line DU145.
22055184 DNA unwinding by ASCC3 helicase is coupled to ALKBH3-dependent DNA alkylation repair and cancer cell proliferation.
21285982 ALKBH3 contributes significantly to cancer cell survival and may be a therapeutic target for human adenocarcinoma of the lung.
20970119 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20714506 This work has provided a detailed understanding of the structural features of the single-stranded DNA and double-stranded DNA preferences of ABH2 and ABH3.
20525795 Divergent sequences outside of the active site determine substrate specificities of ABH3.
More...

AA Sequence

MEEKRRRARVQGAWAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLSDREFVFKEPQQVVRRAPEPR      1 - 70
VIDREGVYEISLSPTGVSRVCLYPGFVDVKEADWILEQLCQDVPWKQRTGIREDITYQQPRLTAWYGELP     71 - 140
YTYSRITMEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFG    141 - 210
ATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPD    211 - 280
PRGAPW                                                                    281 - 286
//

Text Mined References (26)

PMID Year Title
26863410 2016 Transcriptome-wide mapping reveals reversible and dynamic N(1)-methyladenosine methylome.
26863196 2016 The dynamic N(1)-methyladenosine methylome in eukaryotic messenger RNA.
26035443 2015 Clinical significance and therapeutic potential of prostate cancer antigen-1/ALKBH3 in human renal cell carcinoma.
25797601 2015 Differential repair of etheno-DNA adducts by bacterial and human AlkB proteins.
25416956 2014 A proteome-scale map of the human interactome network.
22850567 2012 ALKBH3 contributes to survival and angiogenesis of human urothelial carcinoma cells through NADPH oxidase and tweak/Fn14/VEGF signals.
22826605 2012 PCA-1/ALKBH3 contributes to pancreatic cancer by supporting apoptotic resistance and angiogenesis.
22515525 2012 anti-tumor effect of AlkB homolog 3 knockdown in hormone- independent prostate cancer cells.
22055184 2011 DNA unwinding by ASCC3 helicase is coupled to ALKBH3-dependent DNA alkylation repair and cancer cell proliferation.
21285982 2011 ALKBH3, a human AlkB homologue, contributes to cell survival in human non-small-cell lung cancer.
More...