Property Summary

Ligand Count 18
NCBI Gene PubMed Count 26
PubMed Score 33.24
PubTator Score 31.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.7e-04
group 3 medulloblastoma 4104 6.8e-04
Disease Target Count Z-score Confidence
Cancer 2499 3.053 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.200 6.8e-04
osteosarcoma -1.226 2.7e-04

Gene RIF (15)

AA Sequence

MEEKRRRARVQGAWAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLSDREFVFKEPQQVVRRAPEPR      1 - 70
VIDREGVYEISLSPTGVSRVCLYPGFVDVKEADWILEQLCQDVPWKQRTGIREDITYQQPRLTAWYGELP     71 - 140
YTYSRITMEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFG    141 - 210
ATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPD    211 - 280
PRGAPW                                                                    281 - 286
//

Text Mined References (28)

PMID Year Title