Property Summary

NCBI Gene PubMed Count 17
PubMed Score 4.60
PubTator Score 2.10

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96Q80 F2Z3B6 Q6ICJ6 Q6PEX0 Q6ZUB5
Symbols IZP6
LLN2
C22orf14
derlin-3

Gene

PANTHER Protein Class (1)

Gene RIF (2)

PMID Text
24699711 SLC2A1 overexpression mediated by DERL3 epigenetic loss contributes to the Warburg effect.
16449189 Findings indicate that Derlin-3 provides the missing link between EDEM and p97 in the process of degrading misfolded glycoproteins.

AA Sequence

MAWQGLAAEFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTNFLFFGPLGFS      1 - 70
FFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSLFFLGQALMAMLVYVWSRRSPRVR     71 - 140
VNFFGLLTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGHIYYFLEDVFPNQPGGKRLLQTPGFLKLLLD    141 - 210
APAEDPNYLPLPEEQPGPHLPPPQQ                                                 211 - 235
//

Text Mined References (18)

PMID Year Title
25660456 2015 Identification of ERAD components essential for dislocation of the null Hong Kong variant of ?-1-antitrypsin (NHK).
24699711 2014 A DERL3-associated defect in the degradation of SLC2A1 mediates the Warburg effect.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22607976 2012 STT3B-dependent posttranslational N-glycosylation as a surveillance system for secretory protein.
22016385 2011 Selenoprotein K binds multiprotein complexes and is involved in the regulation of endoplasmic reticulum homeostasis.
22013210 2011 The unfolded protein response: integrating stress signals through the stress sensor IRE1?.
19135427 2009 USP14 inhibits ER-associated degradation via interaction with IRE1alpha.
16449193 2006 Salamander limb regeneration involves the activation of a multipotent skeletal muscle satellite cell population.
16449191 2006 AP-2alpha: a regulator of EGF receptor signaling and proliferation in skin epidermis.
16449189 2006 Derlin-2 and Derlin-3 are regulated by the mammalian unfolded protein response and are required for ER-associated degradation.
More...