Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.37
PubTator Score 1.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 2.1e-02
Breast cancer 2.900 3.2e-02
breast carcinoma -1.200 6.4e-23
group 4 medulloblastoma 1.700 6.2e-07
interstitial cystitis -1.100 3.4e-04
invasive ductal carcinoma -1.700 1.4e-03
medulloblastoma, large-cell 1.300 2.0e-04
non-small cell lung cancer 1.519 8.5e-21
pediatric high grade glioma 1.100 1.4e-04
posterior fossa group B ependymoma 1.200 1.9e-07
primitive neuroectodermal tumor 1.100 2.0e-03
psoriasis -1.100 4.0e-31
subependymal giant cell astrocytoma -1.433 2.8e-02

Gene RIF (2)

AA Sequence

MRTDSGARLEEGHLRPPRALPPVPSQDDIPLSRPKKKKPRTKNTPASASLEGLAQTAGRRPSEGNEPSTK      1 - 70
ELKEHPEAPVQRRQKKTRLPLELETSSTQKKSSSSSLLRNENGIDAEPAEEAVIQKPRRKTKKTQPAELQ     71 - 140
YANELGVEDEDIITDEQTTVEQQSVFTAPTGISQPVGKVFVEKSRRFQAADRSELIKTTENIDVSMDVKP    141 - 210
SWTTRDVALTVHRAFRMIGLFSHGFLAGCAVWNIVVIYVLAGDQLSNLSNLLQQYKTLAYPFQSLLYLLL    211 - 280
ALSTISAFDRIDFAKISVAIRNFLALDPTALASFLYFTALILSLSQQMTSDRIHLYTPSSVNGSLWEAGI    281 - 350
EEQILQPWIVVNLVVALLVGLSWLFLSYRPGMDLSEELMFSSEVEEYPDKEKEIKASS                351 - 408
//

Text Mined References (13)

PMID Year Title