Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.27
PubTator Score 1.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 3.97396716434157E-31
breast carcinoma 1614 6.40424607410756E-23
non-small cell lung cancer 2798 8.54019544806945E-21
posterior fossa group B ependymoma 1530 1.94677161422744E-7
group 4 medulloblastoma 1875 6.18021426017521E-7
pediatric high grade glioma 2712 1.38221308778249E-4
medulloblastoma, large-cell 6234 1.96597578602409E-4
interstitial cystitis 2299 3.42887295971515E-4
invasive ductal carcinoma 2950 0.00142940381618248
primitive neuroectodermal tumor 3031 0.00202836275149955
atypical teratoid / rhabdoid tumor 4369 0.021214145616356
subependymal giant cell astrocytoma 2287 0.0279143164841033
Breast cancer 3099 0.0320542313982513
Disease Target Count Z-score Confidence
Meckel syndrome 48 4.112 2.1

Expression

Synonym

Gene

  Ortholog (12)

Pathway (1)

Gene RIF (1)

PMID Text
22152675 TMEM237 is mutated in individuals with a Joubert syndrome related disorder and expands the role of the TMEM family at the ciliary transition zone

AA Sequence

MRTDSGARLEEGHLRPPRALPPVPSQDDIPLSRPKKKKPRTKNTPASASLEGLAQTAGRRPSEGNEPSTK      1 - 70
ELKEHPEAPVQRRQKKTRLPLELETSSTQKKSSSSSLLRNENGIDAEPAEEAVIQKPRRKTKKTQPAELQ     71 - 140
YANELGVEDEDIITDEQTTVEQQSVFTAPTGISQPVGKVFVEKSRRFQAADRSELIKTTENIDVSMDVKP    141 - 210
SWTTRDVALTVHRAFRMIGLFSHGFLAGCAVWNIVVIYVLAGDQLSNLSNLLQQYKTLAYPFQSLLYLLL    211 - 280
ALSTISAFDRIDFAKISVAIRNFLALDPTALASFLYFTALILSLSQQMTSDRIHLYTPSSVNGSLWEAGI    281 - 350
EEQILQPWIVVNLVVALLVGLSWLFLSYRPGMDLSEELMFSSEVEEYPDKEKEIKASS                351 - 408
//

Text Mined References (12)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22152675 2011 TMEM237 is mutated in individuals with a Joubert syndrome related disorder and expands the role of the TMEM family at the ciliary transition zone.
20375344 2010 Deciphering the structure and function of Als2cr4 in the mouse retina.
19946888 2010 Defining the membrane proteome of NK cells.
18482256 2009 Protein microarray analysis identifies human cellular prion protein interactors.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...