Property Summary

Ligand Count 1
NCBI Gene PubMed Count 14
PubMed Score 0.78
PubTator Score 0.69

Knowledge Summary

Patent (872)

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma 1.200 3.8e-03
atypical teratoid / rhabdoid tumor 1.300 4.7e-03
cystic fibrosis -2.463 5.4e-07
glioblastoma 1.100 1.8e-02
medulloblastoma, large-cell 1.800 5.3e-05
ovarian cancer 1.600 5.6e-10

Gene RIF (1)

AA Sequence

MGQELCAKTVQPGCSCYHCSEGGEAHSCRRSQPETTEAAFKLTDLKEASCSMTSFHPRGLQAARAQKFKS      1 - 70
KRPRSNSDCFQEEDLRQGFQWRKSLPFGAASSYLNLEKLGEGSYATVYKGISRINGQLVALKVISMNAEE     71 - 140
GVPFTAIREASLLKGLKHANIVLLHDIIHTKETLTFVFEYMHTDLAQYMSQHPGGLHPHNVRLFMFQLLR    141 - 210
GLAYIHHQHVLHRDLKPQNLLISHLGELKLADFGLARAKSIPSQTYSSEVVTLWYRPPDALLGATEYSSE    211 - 280
LDIWGAGCIFIEMFQGQPLFPGVSNILEQLEKIWEVLGVPTEDTWPGVSKLPNYNPEWFPLPTPRSLHVV    281 - 350
WNRLGRVPEAEDLASQMLKGFPRDRVSAQEALVHDYFSALPSQLYQLPDEESLFTVSGVRLKPEMCDLLA    351 - 420
SYQKGHHPAQFSKCW                                                           421 - 435
//

Text Mined References (15)

PMID Year Title