Property Summary

NCBI Gene PubMed Count 18
PubMed Score 1.94
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (7)

PMID Text
25855136 rs13014235 is associated with susceptibility to cutaneous basal cell carcinoma.
25168388 Genome-wide association studies show a significant association between the intronic SNP rs1830298 in ALS2CR12 gene and breast cancer; further expression studies suggest that CASP8 might be the target gene.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
18649358 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MYPNPLIYCTCWDPWNLGPRKLIKTPQLPRKNSTGSSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQ      1 - 70
EETNKSFYEVINVSPGYQLVRNREQISVTLGDEMFDRKKRWESEIPDKGRFSRTNIISDLEEQISELTAI     71 - 140
IEQMNRDHQSAQKLLSSEMDLRCAEMKQNFENKNRELKEAHEAELSELENNYKAALKAEKLAAQEKLEEM    141 - 210
GKEYKYLKNMFRTYQDSIYDEMEEKWSKQKAKWKKDEKFERENILLQQKKKMTKKFEMESGEEDKKINES    211 - 280
CSAVFENFIQEKEELLKQHQSDTLQLEELRKTKEVPWRRDQINRHWHDVLQQLLLMQVMQEELHAQALIL    281 - 350
ESLNTNLYYTQLELQKEKAIVGNLEKMLQTKFAETEEKYKHTIQILTEENIHLKQKIISKNEEICEGCSG    351 - 420
RLASITVSKDDSDTVQDGSKKGQES                                                 421 - 445
//

Publication (21)

PMID Year Title
25855136 2015 New basal cell carcinoma susceptibility loci.
25416956 2014 A proteome-scale map of the human interactome network.
25168388 2015 Identification and characterization of novel associations in the CASP8/ALS2CR12 region on chromosome 2 with breast cancer risk.
25129146 2014 Joint analysis of three genome-wide association studies of esophageal squamous cell carcinoma in Chinese populations.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
21983787 2011 Genome-wide association study identifies three new melanoma susceptibility loci.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
More...