Property Summary

NCBI Gene PubMed Count 18
PubMed Score 3.75
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Melanoma 711 0.0 3.0
Disease Target Count Z-score Confidence
Amyotrophic lateral sclerosis type 2 3 5.033 2.5

Expression

  Differential Expression (6)

Disease log2 FC p
chronic rhinosinusitis -1.309 2.1e-02
cystic fibrosis and chronic rhinosinusit... -1.498 2.3e-02
ependymoma 1.300 3.8e-05
lung adenocarcinoma -1.500 1.4e-13
non-small cell lung carcinoma -1.300 3.0e-16
osteosarcoma -1.513 2.2e-03

Gene RIF (7)

AA Sequence

MYPNPLIYCTCWDPWNLGPRKLIKTPQLPRKNSTGSSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQ      1 - 70
EETNKSFYEVINVSPGYQLVRNREQISVTLGDEMFDRKKRWESEIPDKGRFSRTNIISDLEEQISELTAI     71 - 140
IEQMNRDHQSAQKLLSSEMDLRCAEMKQNFENKNRELKEAHEAELSELENNYKAALKAEKLAAQEKLEEM    141 - 210
GKEYKYLKNMFRTYQDSIYDEMEEKWSKQKAKWKKDEKFERENILLQQKKKMTKKFEMESGEEDKKINES    211 - 280
CSAVFENFIQEKEELLKQHQSDTLQLEELRKTKEVPWRRDQINRHWHDVLQQLLLMQVMQEELHAQALIL    281 - 350
ESLNTNLYYTQLELQKEKAIVGNLEKMLQTKFAETEEKYKHTIQILTEENIHLKQKIISKNEEICEGCSG    351 - 420
RLASITVSKDDSDTVQDGSKKGQES                                                 421 - 445
//

Text Mined References (21)

PMID Year Title