Property Summary

NCBI Gene PubMed Count 23
PubMed Score 22.87
PubTator Score 23.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.400 2.5e-04
Astrocytoma, Pilocytic -1.300 5.5e-06
atypical teratoid / rhabdoid tumor -1.800 6.5e-09
ependymoma -1.400 7.8e-14
glioblastoma -1.300 8.3e-09
group 4 medulloblastoma -1.100 1.3e-03
medulloblastoma, large-cell -2.000 6.8e-04
ovarian cancer 1.700 1.2e-09
primitive neuroectodermal tumor -1.600 1.7e-04

Gene RIF (20)

AA Sequence

MSNSHPLRPFTAVGEIDHVHILSEHIGALLIGEEYGDVTFVVEKKRFPAHRVILAARCQYFRALLYGGMR      1 - 70
ESQPEAEIPLQDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKYGFPELEDSTSEYLCTILNIQ     71 - 140
NVCMTFDVASLYSLPKLTCMCCMFMDRNAQEVLSSEGFLSLSKTALLNIVLRDSFAAPEKDIFLALLNWC    141 - 210
KHNSKENHAEIMQAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATM    211 - 280
KYGAQVVKGELKSALLDGDTQNYDLDHGFSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDRDSRSYSYF    281 - 350
IEVSMDELDWVRVIDHSQYLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKTFTLEKGL    351 - 420
IVPMENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYMIGSIRLLLWD    421 - 490
CDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFECPEQQ    491 - 560
SSQKEENSEESGTGDTSLAGQQLDSHALRAPSGSSLPSSPGSNSRSPNRQHQ                      561 - 612
//

Text Mined References (27)

PMID Year Title