Property Summary

NCBI Gene PubMed Count 35
Grant Count 11
R01 Count 7
Funding $1,108,543.33
PubMed Score 133.33
PubTator Score 92.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.200 0.001
adult high grade glioma -1.100 0.001

Gene RIF (14)

PMID Text
25704885 Data identified important roles of NIBP in promoting tumorigenesis via NFkappaBeta signaling.
24040793 Identification and construction of a 3D protein model of trafficking protein particle complex 9 (TRAPPC9), a potetnially interesting molecular target for the development of drug therapy against non syndromic mental retardation
22989526 A homozygous splice site mutation in TRAPPC9 causes intellectual disability and microcephaly.
22549410 By detailed phenotypic analysis of our patients, and by critical literature review, we found that homozygous TRAPPC9 loss-of-function mutations cause a distinctive phenotype, characterized by peculiar facial appearance, obesity, hypotonia
22279557 Data suggest that TRAPPC9 serves to uncouple p150(Glued) from the COPII coat, and to relay the vesicle-dynactin interaction at the target membrane.
21858081 Data show that a disease-causing mutation of TRAPPC2, D47Y, failed to interact with either TRAPPC9 or TRAPPC8, suggesting that aspartate 47 in TRAPPC2 is at or near the site of interaction with TRAPPC9 or TRAPPC8.
20966969 Studies indicate that a truncation of TRAPPC9 leads to mental retardation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
20004765 TRAPPC9, encodes the NIK- and IKK-beta-binding protein, has a role in nonsyndromic autosomal-recessive mental retardation
More...

AA Sequence

MSVPDYMQCAEDHQTLLVVVQPVGIVSEENFFRIYKRICSVSQISVRDSQRVLYIRYRHHYPPENNEWGD      1 - 70
FQTHRKVVGLITITDCFSAKDWPQTFEKFHVQKEIYGSTLYDSRLFVFGLQGEIVEQPRTDVAFYPNYED     71 - 140
CQTVEKRIEDFIESLFIVLESKRLDRATDKSGDKIPLLCVPFEKKDFVGLDTDSRHYKKRCQGRMRKHVG    141 - 210
DLCLQAGMLQDSLVHYHMSVELLRSVNDFLWLGAALEGLCSASVIYHYPGGTGGKSGARRFQGSTLPAEA    211 - 280
ANRHRPGAQEVLIDPGALTTNGINPDTSTEIGRAKNCLSPEDIIDKYKEAISYYSKYKNAGVIELEACIK    281 - 350
AVRVLAIQKRSMEASEFLQNAVYINLRQLSEEEKIQRYSILSELYELIGFHRKSAFFKRVAAMQCVAPSI    351 - 420
AEPGWRACYKLLLETLPGYSLSLDPKDFSRGTHRGWAAVQMRLLHELVYASRRMGNPALSVRHLSFLLQT    421 - 490
MLDFLSDQEKKDVAQSLENYTSKCPGTMEPIALPGGLTLPPVPFTKLPIVRHVKLLNLPASLRPHKMKSL    491 - 560
LGQNVSTKSPFIYSPIIAHNRGEERNKKIDFQWVQGDVCEVQLMVYNPMPFELRVENMGLLTSGVEFESL    561 - 630
PAALSLPAESGLYPVTLVGVPQTTGTITVNGYHTTVFGVFSDCLLDNLPGIKTSGSTVEVIPALPRLQIS    631 - 700
TSLPRSAHSLQPSSGDEISTNVSVQLYNGESQQLIIKLENIGMEPLEKLEVTSKVLTTKEKLYGDFLSWK    701 - 770
LEETLAQFPLQPGKVATFTINIKVKLDFSCQENLLQDLSDDGISVSGFPLSSPFRQVVRPRVEGKPVNPP    771 - 840
ESNKAGDYSHVKTLEAVLNFKYSGGPGHTEGYYRNLSLGLHVEVEPSVFFTRVSTLPATSTRQCHLLLDV    841 - 910
FNSTEHELTVSTRSSEALILHAGECQRMAIQVDKFNFESFPESPGEKGQFANPKQLEEERREARGLEIHS    911 - 980
KLGICWRIPSLKRSGEASVEGLLNQLVLEHLQLAPLQWDVLVDGQPCDREAVAACQVGDPVRLEVRLTNR    981 - 1050
SPRSVGPFALTVVPFQDHQNGVHNYDLHDTVSFVGSSTFYLDAVQPSGQSACLGALLFLYTGDFFLHIRF   1051 - 1120
HEDSTSKELPPSWFCLPSVHVCALEAQA                                             1121 - 1148
//

Text Mined References (43)

PMID Year Title
26596835 2016 NIK- and IKK?-binding protein promotes colon cancer metastasis by activating the classical NF-?B pathway and MMPs.
25704885 2015 Elevated NIBP/TRAPPC9 mediates tumorigenesis of cancer cells through NF?B signaling.
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
25018876 2014 Identification of conserved, centrosome-targeting ASH domains in TRAPPII complex subunits and TRAPPC8.
24980697 2014 Screening individuals with intellectual disability, autism and Tourette's syndrome for KCNK9 mutations and aberrant DNA methylation within the 8q24 imprinted cluster.
24776741 2014 De novo mutations in schizophrenia implicate chromatin remodeling and support a genetic overlap with autism and intellectual disability.
24667089 2014 The PEG13-DMR and brain-specific enhancers dictate imprinted expression within the 8q24 intellectual disability risk locus.
24040793 2014 Computational analysis of TRAPPC9: candidate gene for autosomal recessive non-syndromic mental retardation.
23474757 2014 Identification of novel determinants of resistance to lapatinib in ERBB2-amplified cancers.
23412934 2013 A genome-wide association study of brain lesion distribution in multiple sclerosis.
More...