Property Summary

NCBI Gene PubMed Count 17
Grant Count 1
Funding $47,946
PubMed Score 16.91
PubTator Score 19.69

Knowledge Summary

Patent (3,067)

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
posterior fossa group B ependymoma -2.200 0.000
group 3 medulloblastoma -2.300 0.002

Synonym

Accession Q96Q04 Q4G0U1
Symbols LMR3
TYKLM3
PPP1R101

Gene

 Grant Application (1)

 Collection (1)

Gene RIF (13)

PMID Text
26739063 LMTK3 escapes tumour suppressor miRNAs via sequestration of DDX5.
26212333 LMTK3 functions at distal regions in tethering the chromatin to the nuclear periphery, resulting in H3K9me3 modification and gene silencing.
25755755 The serum LMTK3 level was significantly increased in human non-small cell lung cancer, and could be used as a potential and valuable biomarker
25163465 Results show that high expression of LMTK3 is an independent prognostic factor in estrogen receptor alpha-positive breast cancer patients receiving adjuvant endocrine therapy
24939894 abundance of LMTK3 positively correlated with that of the integrin beta1 subunit in breast cancer patient's tumors
24695631 LMTK3 expression was an independent prognostic factor for colorectal cancer patients
24619340 These computational reports provide more information on the structure-function relationship of LMTK3 with ATP.
24174317 Kaplan-Meier survival curves showed that colorectal cancer patients with high levels of sLMTK3 had a poorer overall survival rate when compared with those of patients with low levels of sLMTK3.
24050776 miR-34a inhibits breast cancer proliferation by targeting LMTK3
23918832 harboring rs8108419 G/G genotype of the LMTK3 was associated with OS in the Japanese females (HR, 3.04; 95% CI, 1.08-8.56; P = 0.035) and the U.S. males (HR, 3.39; 95% CI, 1.31-8.80; P = 0.012).
More...

AA Sequence

MPAPGALILLAAVSASGCLASPAHPDGFALGRAPLAPPYAVVLISCSGLLAFIFLLLTCLCCKRGDVGFK      1 - 70
EFENPEGEDCSGEYTPPAEETSSSQSLPDVYILPLAEVSLPMPAPQPSHSDMTTPLGLSRQHLSYLQEIG     71 - 140
SGWFGKVILGEIFSDYTPAQVVVKELRASAGPLEQRKFISEAQPYRSLQHPNVLQCLGLCVETLPFLLIM    141 - 210
EFCQLGDLKRYLRAQRPPEGLSPELPPRDLRTLQRMGLEIARGLAHLHSHNYVHSDLALRNCLLTSDLTV    211 - 280
RIGDYGLAHSNYKEDYYLTPERLWIPLRWAAPELLGELHGTFMVVDQSRESNIWSLGVTLWELFEFGAQP    281 - 350
YRHLSDEEVLAFVVRQQHVKLARPRLKLPYADYWYDILQSCWRPPAQRPSASDLQLQLTYLLSERPPRPP    351 - 420
PPPPPPRDGPFPWPWPPAHSAPRPGTLSSPFPLLDGFPGADPDDVLTVTESSRGLNLECLWEKARRGAGR    421 - 490
GGGAPAWQPASAPPAPHANPSNPFYEALSTPSVLPVISARSPSVSSEYYIRLEEHGSPPEPLFPNDWDPL    491 - 560
DPGVPAPQAPQAPSEVPQLVSETWASPLFPAPRPFPAQSSASGSFLLSGWDPEGRGAGETLAGDPAEVLG    561 - 630
ERGTAPWVEEEEEEEEGSSPGEDSSSLGGGPSRRGPLPCPLCSREGACSCLPLERGDAVAGWGGHPALGC    631 - 700
PHPPEDDSSLRAERGSLADLPMAPPASAPPEFLDPLMGAAAPQYPGRGPPPAPPPPPPPPRAPADPAASP    701 - 770
DPPSAVASPGSGLSSPGPKPGDSGYETETPFSPEGAFPGGGAAEEEGVPRPRAPPEPPDPGAPRPPPDPG    771 - 840
PLPLPGPREKPTFVVQVSTEQLLMSLREDVTRNLLGEKGATARETGPRKAGRGPGNREKVPGLNRDPTVL    841 - 910
GNGKQAPSLSLPVNGVTVLENGDQRAPGIEEKAAENGALGSPEREEKVLENGELTPPRREEKALENGELR    911 - 980
SPEAGEKVLVNGGLTPPKSEDKVSENGGLRFPRNTERPPETGPWRAPGPWEKTPESWGPAPTIGEPAPET    981 - 1050
SLERAPAPSAVVSSRNGGETAPGPLGPAPKNGTLEPGTERRAPETGGAPRAPGAGRLDLGSGGRAPVGTG   1051 - 1120
TAPGGGPGSGVDAKAGWVDNTRPQPPPPPLPPPPEAQPRRLEPAPPRARPEVAPEGEPGAPDSRAGGDTA   1121 - 1190
LSGDGDPPKPERKGPEMPRLFLDLGPPQGNSEQIKARLSRLSLALPPLTLTPFPGPGPRRPPWEGADAGA   1191 - 1260
AGGEAGGAGAPGPAEEDGEDEDEDEEEDEEAAAPGAAAGPRGPGRARAAPVPVVVSSADADAARPLRGLL   1261 - 1330
KSPRGADEPEDSELERKRKMVSFHGDVTVYLFDQETPTNELSVQAPPEGDTDPSTPPAPPTPPHPATPGD   1331 - 1400
GFPSNDSGFGGSFEWAEDFPLLPPPGPPLCFSRFSVSPALETPGPPARAPDARPAGPVEN             1401 - 1460
//

Text Mined References (18)

PMID Year Title
26739063 2016 LMTK3 escapes tumour suppressor miRNAs via sequestration of DDX5.
26212333 2015 LMTK3 Represses Tumor Suppressor-like Genes through Chromatin Remodeling in Breast Cancer.
25755755 2015 Serum lemur tyrosine kinase-3: a novel biomarker for screening primary non-small cell lung cancer and predicting cancer progression.
25163465 2014 High expression of LMTK3 is an independent factor indicating a poor prognosis in estrogen receptor ?-positive breast cancer patients.
24939894 2014 The kinase LMTK3 promotes invasion in breast cancer through GRB2-mediated induction of integrin ??.
24695631 2014 Lemur tyrosine kinase-3 is a significant prognostic marker for patients with colorectal cancer.
24619340 2014 Structural modeling and molecular dynamics studies on the human LMTK3 domain and the mechanism of ATP binding.
24174317 2013 Serum lemur tyrosine kinase 3 expression in colorectal cancer patients predicts cancer progression and prognosis.
24050776 2013 MicroRNA-34a suppresses cell proliferation by targeting LMTK3 in human breast cancer mcf-7 cell line.
23918832 2013 Prognostic role of lemur tyrosine kinase-3 germline polymorphisms in adjuvant gastric cancer in Japan and the United States.
More...