Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.05
PubTator Score 6.32

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
24635597 Together, these data suggest that FAM111A may also be important in the development and function of male genitalia. 394
24561620 FAM111A is a replication factor required for PCNA loading.
23996431 study would provide evidence that FAM111A is a key molecule for normal bone development, height gain, and parathyroid hormone development and/or regulation
23684011 FAM111A appears to be crucial to a pathway that governs parathyroid hormone production, calcium homeostasis, and skeletal development and growth.
23093934 FAM111A functions as a host range restriction factor that is specifically targeted by SV40 large T antigen

AA Sequence

MSCKKQRSRKHSVNEKCNMKIEHYFSPVSKEQQNNCSTSLMRMESRGDPRATTNTQAQRFHSPKKNPEDQ      1 - 70
TMPQNRTIYVTLKVNHRRNQDMKLKLTHSENSSLYMALNTLQAVRKEIETHQGQEMLVRGTEGIKEYINL     71 - 140
GMPLSCFPEGGQVVITFSQSKSKQKEDNHIFGRQDKASTECVKFYIHAIGIGKCKRRIVKCGKLHKKGRK    141 - 210
LCVYAFKGETIKDALCKDGRFLSFLENDDWKLIENNDTILESTQPVDELEGRYFQVEVEKRMVPSAAASQ    211 - 280
NPESEKRNTCVLREQIVAQYPSLKRESEKIIENFKKKMKVKNGETLFELHRTTFGKVTKNSSSIKVVKLL    281 - 350
VRLSDSVGYLFWDSATTGYATCFVFKGLFILTCRHVIDSIVGDGIEPSKWATIIGQCVRVTFGYEELKDK    351 - 420
ETNYFFVEPWFEIHNEELDYAVLKLKENGQQVPMELYNGITPVPLSGLIHIIGHPYGEKKQIDACAVIPQ    421 - 490
GQRAKKCQERVQSKKAESPEYVHMYTQRSFQKIVHNPDVITYDTEFFFGASGSPVFDSKGSLVAMHAAGF    491 - 560
AYTYQNETRSIIEFGSTMESILLDIKQRHKPWYEEVFVNQQDVEMMSDEDL                       561 - 611
//

Text Mined References (12)

PMID Year Title
24635597 2014 Mother-to-daughter transmission of Kenny-Caffey syndrome associated with the recurrent, dominant FAM111A mutation p.Arg569His.
24561620 2014 Nascent chromatin capture proteomics determines chromatin dynamics during DNA replication and identifies unknown fork components.
23996431 2014 A recurrent de novo FAM111A mutation causes Kenny-Caffey syndrome type 2.
23684011 2013 FAM111A mutations result in hypoparathyroidism and impaired skeletal development.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23093934 2012 Identification of FAM111A as an SV40 host range restriction and adenovirus helper factor.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...