Property Summary

NCBI Gene PubMed Count 11
PubMed Score 8.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.040 6.2e-05
colon cancer 1.800 1.7e-07
diabetes mellitus -1.300 1.1e-03
glioblastoma 1.100 2.4e-02
group 3 medulloblastoma 1.600 2.4e-04
invasive ductal carcinoma 1.100 1.8e-02
lung cancer 2.500 5.1e-04
medulloblastoma, large-cell 1.700 3.4e-04
nasopharyngeal carcinoma 1.400 6.0e-04
non-small cell lung cancer 1.367 3.2e-18
ovarian cancer 2.500 5.3e-06
pancreatic cancer 1.100 8.6e-03
pancreatic carcinoma 1.100 8.6e-03
Pick disease -1.400 1.3e-05
progressive supranuclear palsy -1.100 2.9e-02

Synonym

Accession Q96PZ0 Q75MG4 Q9NX19
Symbols

Gene

PDB

5KKP  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MEMTEMTGVSLKRGALVVEDNDSGVPVEETKKQKLSECSLTKGQDGLQNDFLSISEDVPRPPDTVSTGKG      1 - 70
GKNSEAQLEDEEEEEEDGLSEECEEEESESFADMMKHGLTEADVGITKFVSSHQGFSGILKERYSDFVVH     71 - 140
EIGKDGRISHLNDLSIPVDEEDPSEDIFTVLTAEEKQRLEELQLFKNKETSVAIEVIEDTKEKRTIIHQA    141 - 210
IKSLFPGLETKTEDREGKKYIVAYHAAGKKALANPRKHSWPKSRGSYCHFVLYKENKDTMDAINVLSKYL    211 - 280
RVKPNIFSYMGTKDKRAITVQEIAVLKITAQRLAHLNKCLMNFKLGNFSYQKNPLKLGELQGNHFTVVLR    281 - 350
NITGTDDQVQQAMNSLKEIGFINYYGMQRFGTTAVPTYQVGRAILQNSWTEVMDLILKPRSGAEKGYLVK    351 - 420
CREEWAKTKDPTAALRKLPVKRCVEGQLLRGLSKYGMKNIVSAFGIIPRNNRLMYIHSYQSYVWNNMVSK    421 - 490
RIEDYGLKPVPGDLVLKGATATYIEEDDVNNYSIHDVVMPLPGFDVIYPKHKIQEAYREMLTADNLDIDN    491 - 560
MRHKIRDYSLSGAYRKIIIRPQNVSWEVVAYDDPKIPLFNTDVDNLEGKTPPVFASEGKYRALKMDFSLP    561 - 630
PSTYATMAIREVLKMDTSIKNQTQLNTTWLR                                           631 - 661
//

Text Mined References (16)

PMID Year Title