Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 3.18619336716932E-18
colon cancer 1475 1.73615151244007E-7
ovarian cancer 8492 5.28661478975386E-6
Pick disease 1893 1.2524531143109E-5
acute quadriplegic myopathy 1157 6.22042428065808E-5
group 3 medulloblastoma 2254 2.37933696728167E-4
medulloblastoma, large-cell 6234 3.40773782037047E-4
lung cancer 4473 5.14212273749571E-4
nasopharyngeal carcinoma 1056 6.03465735101499E-4
diabetes mellitus 1663 0.00110107034418028
pancreatic cancer 2300 0.00856245929384157
pancreatic carcinoma 567 0.00856245929384161
invasive ductal carcinoma 2950 0.0183375932237068
glioblastoma 5572 0.0237933121319758
progressive supranuclear palsy 674 0.0292152924272981
Disease Target Count Z-score Confidence
Dyskeratosis congenita 24 3.947 2.0
Phenylketonuria 18 3.719 1.9

Expression

  Differential Expression (15)

Disease log2 FC p
pancreatic cancer 1.100 0.009
glioblastoma 1.100 0.024
medulloblastoma, large-cell 1.700 0.000
acute quadriplegic myopathy 1.040 0.000
non-small cell lung cancer 1.367 0.000
lung cancer 2.500 0.001
colon cancer 1.800 0.000
diabetes mellitus -1.300 0.001
group 3 medulloblastoma 1.600 0.000
pancreatic carcinoma 1.100 0.009
nasopharyngeal carcinoma 1.400 0.001
Pick disease -1.400 0.000
progressive supranuclear palsy -1.100 0.029
invasive ductal carcinoma 1.100 0.018
ovarian cancer 2.500 0.000

Synonym

Accession Q96PZ0 Q75MG4 Q9NX19
Symbols

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEMTEMTGVSLKRGALVVEDNDSGVPVEETKKQKLSECSLTKGQDGLQNDFLSISEDVPRPPDTVSTGKG      1 - 70
GKNSEAQLEDEEEEEEDGLSEECEEEESESFADMMKHGLTEADVGITKFVSSHQGFSGILKERYSDFVVH     71 - 140
EIGKDGRISHLNDLSIPVDEEDPSEDIFTVLTAEEKQRLEELQLFKNKETSVAIEVIEDTKEKRTIIHQA    141 - 210
IKSLFPGLETKTEDREGKKYIVAYHAAGKKALANPRKHSWPKSRGSYCHFVLYKENKDTMDAINVLSKYL    211 - 280
RVKPNIFSYMGTKDKRAITVQEIAVLKITAQRLAHLNKCLMNFKLGNFSYQKNPLKLGELQGNHFTVVLR    281 - 350
NITGTDDQVQQAMNSLKEIGFINYYGMQRFGTTAVPTYQVGRAILQNSWTEVMDLILKPRSGAEKGYLVK    351 - 420
CREEWAKTKDPTAALRKLPVKRCVEGQLLRGLSKYGMKNIVSAFGIIPRNNRLMYIHSYQSYVWNNMVSK    421 - 490
RIEDYGLKPVPGDLVLKGATATYIEEDDVNNYSIHDVVMPLPGFDVIYPKHKIQEAYREMLTADNLDIDN    491 - 560
MRHKIRDYSLSGAYRKIIIRPQNVSWEVVAYDDPKIPLFNTDVDNLEGKTPPVFASEGKYRALKMDFSLP    561 - 630
PSTYATMAIREVLKMDTSIKNQTQLNTTWLR                                           631 - 661
//

Text Mined References (16)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24322204 2014 Genome-wide association study of bipolar disorder accounting for effect of body mass index identifies a new risk allele in TCF7L2.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...