Property Summary

NCBI Gene PubMed Count 33
Grant Count 34
R01 Count 28
Funding $3,362,313.66
PubMed Score 44.00
PubTator Score 25.82

Knowledge Summary

Patent (1,615)

Expression

  Differential Expression (11)

Pathway (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (15)

PMID Text
26290490 C21ORF2 functions in the same pathway as NEK1 in DNA damage repair.
23851348 Nek1 may facilitate S-phase progression by interacting with Ku80 and regulating chromatin loading of replication factors.
23345434 as an ATR-associated kinase, Nek1 enhances the stability and activity of ATR-ATRIP before DNA damage, priming ATR-ATRIP for a robust DNA damage response
23255108 Nek1 may suppress cilia by phosphorylating pVHL, which is critical to microtubule stabilization and ciliary stability.
22499340 This study confirms that NEK1 is one gene causing SRP type II but also reports mutations in DYNC2H1, expanding the phenotypic spectrum of DYNC2H1 mutations.
22482978 The present case provides evidence for a correlation of NEK1 mutation with short rib-polydactyly syndrome type II (Majewski.
21301226 results demonstrate that Nek1 is important for proper checkpoint control and characterize for the first time a DNA damage response that does not directly involve one of the known upstream mediator kinases, ATM or ATR
21211617 absence of functional full-length NEK1 severely reduces cilia number and alters ciliar morphology in vivo.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20501547 Nek1 is involved in the beginning of the cellular response to genotoxic stress and plays an important role in preventing cell death induced by DNA damage.
More...

AA Sequence

MEKYVRLQKIGEGSFGKAILVKSTEDGRQYVIKEINISRMSSKEREESRREVAVLANMKHPNIVQYRESF      1 - 70
EENGSLYIVMDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDG     71 - 140
TVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGSMKN    141 - 210
LVLKIISGSFPPVSLHYSYDLRSLVSQLFKRNPRDRPSVNSILEKGFIAKRIEKFLSPQLIAEEFCLKTF    211 - 280
SKFGSQPIPAKRPASGQNSISVMPAQKITKPAAKYGIPLAYKKYGDKKLHEKKPLQKHKQAHQTPEKRVN    281 - 350
TGEERRKISEEAARKRRLEFIEKEKKQKDQIISLMKAEQMKRQEKERLERINRAREQGWRNVLSAGGSGE    351 - 420
VKAPFLGSGGTIAPSSFSSRGQYEHYHAIFDQMQQQRAEDNEAKWKREIYGRGLPERGILPGVRPGFPYG    421 - 490
AAGHHHFPDADDIRKTLKRLKAVSKQANANRQKGQLAVERAKQVEEFLQRKREAMQNKARAEGHMVYLAR    491 - 560
LRQIRLQNFNERQQIKAKLRGEKKEANHSEGQEGSEEADMRRKKIESLKAHANARAAVLKEQLERKRKEA    561 - 630
YEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQ    631 - 700
KTNNAISSKREILRRLNENLKAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPL    701 - 770
DELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTDSVLKILGEAELQLQTELLENTTIRSEISPEG    771 - 840
EKYKPLITGEKKVQCISHEINPSAIVDSPVETKSPEFSEASPQMSLKLEGNLEEPDDLETEILQEPSGTN    841 - 910
KDESLPCTITDVWISEEKETKETQSADRITIQENEVSEDGVSSTVDQLSDIHIEPGTNDSQHSKCDVDKS    911 - 980
VQPEPFFHKVVHSEHLNLVPQVQSVQCSPEESFAFRSHSHLPPKNKNKNSLLIGLSTGLFDANNPKMLRT    981 - 1050
CSLPDLSKLFRTLMDVPTVGDVRQDNLEIDEIEDENIKEGPSDSEDIVFEETDTDLQELQASMEQLLREQ   1051 - 1120
PGEEYSEEEESVLKNSDVEPTANGTDVADEDDNPSSESALNEEWHSDNSDGEIASECECDSVFNHLEELR   1121 - 1190
LHLEQEMGFEKFFEVYEKIKAIHEDEDENIEICSKIVQNILGNEHQHLYAKILHLVMADGAYQEDNDE     1191 - 1258
//

Publication (43)

PMID Year Title
27455347 2016 NEK1 variants confer susceptibility to amyotrophic lateral sclerosis.
26945885 2016 NEK1 mutations in familial amyotrophic lateral sclerosis.
26290490 2015 The NEK1 interactor, C21ORF2, is required for efficient DNA damage repair.
26167768 2015 An siRNA-based functional genomics screen for the identification of regulators of ciliogenesis and ciliopathy genes.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24947832 2014 Differential protein-protein interactions of LRRK1 and LRRK2 indicate roles in distinct cellular signaling pathways.
24510904 2014 Unbiased screen for interactors of leucine-rich repeat kinase 2 supports a common pathway for sporadic and familial Parkinson disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23851348 2013 Nek1 interacts with Ku80 to assist chromatin loading of replication factors and S-phase progression.
23345434 2013 Nek1 kinase associates with ATR-ATRIP and primes ATR for efficient DNA damage signaling.
More...