Property Summary

NCBI Gene PubMed Count 25
PubMed Score 15.66
PubTator Score 15.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.77609449353885E-8
cystic fibrosis 1670 9.21420472010865E-7
nasopharyngeal carcinoma 1056 1.72409986697496E-6
breast carcinoma 1614 1.14806034765635E-5
Pick disease 1893 2.37902094406362E-5
osteosarcoma 7933 5.66991177902404E-5
psoriasis 6685 4.2756911374362E-4
ovarian cancer 8492 5.03853787031665E-4
pituitary cancer 1972 8.5751143394963E-4
atypical teratoid / rhabdoid tumor 4369 0.00293697234285598
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0077702284690659
primary pancreatic ductal adenocarcinoma 1271 0.0105579585704961
gastric carcinoma 832 0.0163824503019454
pancreatic cancer 2300 0.020174901287906
tuberculosis 1563 0.0422013870977021
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 1.0

Expression

  Differential Expression (15)

Disease log2 FC p
osteosarcoma 2.273 0.000
cystic fibrosis 2.149 0.000
atypical teratoid / rhabdoid tumor -1.400 0.003
juvenile dermatomyositis 1.214 0.000
primary pancreatic ductal adenocarcinoma 1.301 0.011
tuberculosis 1.100 0.042
intraductal papillary-mucinous adenoma (... 1.300 0.008
breast carcinoma -1.200 0.000
nasopharyngeal carcinoma 1.700 0.000
psoriasis -1.300 0.000
Pick disease 1.500 0.000
gastric carcinoma 1.200 0.016
ovarian cancer 1.500 0.001
pituitary cancer -2.100 0.001
pancreatic cancer 1.200 0.020

Synonym

Accession Q96PY5 B2RZH5 Q14CC9 Q4ZG52 Q8N3E0
Symbols FHOD2

Gene

PDB

4YC7  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid

 GWAS Trait (1)

Gene RIF (15)

PMID Text
26564775 Capping protein and FMNL2 functionally coregulate filament barbed-end assembly.
26515696 miR-206 functioned as a tumor suppressor in the progression of colorectal cancer(CRC) by targeting FMNL2 and c-MET. Restoration of miR-206 expression may represent a promising therapeutic approach for targeting malignant CRC.
26256210 These data establish a role for FMNL2 in the regulation of beta1-integrin and provide a mechanistic understanding of the function of FMNL2 in cancer invasiveness.
26103003 MiR-34a was down-regulated in colorectal cancer cells and inversely correlated with FMNL2 and E2F5 expressions. Our study suggests that miR-34a is an important tumor suppressor of CRC progression by targeting FMNL2 and E2F5.
25963818 Rac1-induced actin assembly and subsequent AJ formation critically depends on FMNL2.
25963737 The two interacting FMNL-Cdc42 heterodimers expose six membrane interaction motifs on a convex protein surface, the assembly of which may facilitate actin filament elongation at the leading edge of lamellipodia and filopodia.
23201162 miR-137, induced by its upstream transcription factor HMGA1, can suppress colorectal cancer cell invasion and metastasis by targeting FMNL2.
22790947 Protein N-myristoylation plays critical roles in the cellular morphological changes induced by FMNL2 and FMNL3.
22608513 FMNL2 is a novel elongation factor of actin filaments that constitutes the first Cdc42 effector promoting cell migration and actin polymerization at the tips of lamellipodia.
21496865 formin-like 2 expression correlated positively with tumor differentiation (P = .046) and vascular invasion (P = .008). Patients whose tumors had lower formin-like 2 expression had shorter overall survival times
More...

AA Sequence

MGNAGSMDSQQTDFRAHNVPLKLPMPEPGELEERFAIVLNAMNLPPDKARLLRQYDNEKKWELICDQERF      1 - 70
QVKNPPHTYIQKLKGYLDPAVTRKKFRRRVQESTQVLRELEISLRTNHIGWVREFLNEENKGLDVLVEYL     71 - 140
SFAQYAVTFDFESVESTVESSVDKSKPWSRSIEDLHRGSNLPSPVGNSVSRSGRHSALRYNTLPSRRTLK    141 - 210
NSRLVSKKDDVHVCIMCLRAIMNYQYGFNMVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGH    211 - 280
EIILSAFDNFKEVCGEKQRFEKLMEHFRNEDNNIDFMVASMQFINIVVHSVEDMNFRVHLQYEFTKLGLD    281 - 350
EYLDKLKHTESDKLQVQIQAYLDNVFDVGALLEDAETKNAALERVEELEENISHLSEKLQDTENEAMSKI    351 - 420
VELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEKQGTIKIQKKGDGD    421 - 490
IAILPVVASGTLSMGSEVVAGNSVGPTMGAASSGPLPPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPP    491 - 560
PPPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPPLPGTSSPTVVFNSGLAAVKIKKPIKTKFRMPVFN    561 - 630
WVALKPNQINGTVFNEIDDERILEDLNVDEFEEIFKTKAQGPAIDLSSSKQKIPQKGSNKVTLLEANRAK    631 - 700
NLAITLRKAGKTADEICKAIHVFDLKTLPVDFVECLMRFLPTENEVKVLRLYERERKPLENLSDEDRFMM    701 - 770
QFSKIERLMQKMTIMAFIGNFAESIQMLTPQLHAIIAASVSIKSSQKLKKILEIILALGNYMNSSKRGAV    771 - 840
YGFKLQSLDLLLDTKSTDRKQTLLHYISNVVKEKYHQVSLFYNELHYVEKAAAVSLENVLLDVKELQRGM    841 - 910
DLTKREYTMHDHNTLLKEFILNNEGKLKKLQDDAKIAQDAFDDVVKYFGENPKTTPPSVFFPVFVRFVKA    911 - 980
YKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQQELIAELRRRQVKDNRHVYEGKDGA    981 - 1050
IEDIITVLKTVPFTARTAKRGSRFFCEPVLTEEYHY                                     1051 - 1086
//

Text Mined References (32)

PMID Year Title
26564775 2015 Formin and capping protein together embrace the actin filament in a ménage à trois.
26515696 2016 MicroRNA-206 functions as a tumor suppressor in colorectal cancer by targeting FMNL2.
26256210 2015 Formin-like 2 Promotes ?1-Integrin Trafficking and Invasive Motility Downstream of PKC?.
26103003 2015 MicroRNA-34a targets FMNL2 and E2F5 and suppresses the progression of colorectal cancer.
25963818 2015 Junctional actin assembly is mediated by Formin-like 2 downstream of Rac1.
25963737 2015 The structure of FMNL2-Cdc42 yields insights into the mechanism of lamellipodia and filopodia formation.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23201162 2013 MicroRNA-137, an HMGA1 target, suppresses colorectal cancer cell invasion and metastasis in mice by directly targeting FMNL2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...