Property Summary

NCBI Gene PubMed Count 25
PubMed Score 15.66
PubTator Score 15.30

Knowledge Summary


No data available


  Differential Expression (15)

Disease log2 FC p
osteosarcoma 2.273 0.000
cystic fibrosis 2.149 0.000
atypical teratoid / rhabdoid tumor -1.400 0.003
juvenile dermatomyositis 1.214 0.000
primary pancreatic ductal adenocarcinoma 1.301 0.011
tuberculosis 1.100 0.042
intraductal papillary-mucinous adenoma (... 1.300 0.008
breast carcinoma -1.200 0.000
nasopharyngeal carcinoma 1.700 0.000
psoriasis -1.300 0.000
Pick disease 1.500 0.000
gastric carcinoma 1.200 0.016
ovarian cancer 1.500 0.001
pituitary cancer -2.100 0.001
pancreatic cancer 1.200 0.020

Gene RIF (15)

26564775 Capping protein and FMNL2 functionally coregulate filament barbed-end assembly.
26515696 miR-206 functioned as a tumor suppressor in the progression of colorectal cancer(CRC) by targeting FMNL2 and c-MET. Restoration of miR-206 expression may represent a promising therapeutic approach for targeting malignant CRC.
26256210 These data establish a role for FMNL2 in the regulation of beta1-integrin and provide a mechanistic understanding of the function of FMNL2 in cancer invasiveness.
26103003 MiR-34a was down-regulated in colorectal cancer cells and inversely correlated with FMNL2 and E2F5 expressions. Our study suggests that miR-34a is an important tumor suppressor of CRC progression by targeting FMNL2 and E2F5.
25963818 Rac1-induced actin assembly and subsequent AJ formation critically depends on FMNL2.
25963737 The two interacting FMNL-Cdc42 heterodimers expose six membrane interaction motifs on a convex protein surface, the assembly of which may facilitate actin filament elongation at the leading edge of lamellipodia and filopodia.
23201162 miR-137, induced by its upstream transcription factor HMGA1, can suppress colorectal cancer cell invasion and metastasis by targeting FMNL2.
22790947 Protein N-myristoylation plays critical roles in the cellular morphological changes induced by FMNL2 and FMNL3.
22608513 FMNL2 is a novel elongation factor of actin filaments that constitutes the first Cdc42 effector promoting cell migration and actin polymerization at the tips of lamellipodia.
21496865 formin-like 2 expression correlated positively with tumor differentiation (P = .046) and vascular invasion (P = .008). Patients whose tumors had lower formin-like 2 expression had shorter overall survival times

AA Sequence

IEDIITVLKTVPFTARTAKRGSRFFCEPVLTEEYHY                                     1051 - 1086

Publication (32)

PMID Year Title
26564775 2015 Formin and capping protein together embrace the actin filament in a ménage à trois.
26515696 2016 MicroRNA-206 functions as a tumor suppressor in colorectal cancer by targeting FMNL2.
26256210 2015 Formin-like 2 Promotes ?1-Integrin Trafficking and Invasive Motility Downstream of PKC?.
26103003 2015 MicroRNA-34a targets FMNL2 and E2F5 and suppresses the progression of colorectal cancer.
25963818 2015 Junctional actin assembly is mediated by Formin-like 2 downstream of Rac1.
25963737 2015 The structure of FMNL2-Cdc42 yields insights into the mechanism of lamellipodia and filopodia formation.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23201162 2013 MicroRNA-137, an HMGA1 target, suppresses colorectal cancer cell invasion and metastasis in mice by directly targeting FMNL2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.