Property Summary

NCBI Gene PubMed Count 28
PubMed Score 18.05
PubTator Score 15.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 2.9e-03
breast carcinoma -1.200 1.1e-05
cystic fibrosis 2.149 9.2e-07
gastric carcinoma 1.200 1.6e-02
intraductal papillary-mucinous adenoma (... 1.300 7.8e-03
juvenile dermatomyositis 1.214 1.8e-08
nasopharyngeal carcinoma 1.700 1.7e-06
osteosarcoma 2.273 5.7e-05
ovarian cancer 1.500 5.0e-04
pancreatic cancer 1.200 2.0e-02
Pick disease 1.500 2.4e-05
pituitary cancer -2.100 8.6e-04
primary pancreatic ductal adenocarcinoma 1.301 1.1e-02
psoriasis -1.300 4.3e-04
tuberculosis 1.100 4.2e-02

Protein-protein Interaction (10)

Gene RIF (18)

AA Sequence

MGNAGSMDSQQTDFRAHNVPLKLPMPEPGELEERFAIVLNAMNLPPDKARLLRQYDNEKKWELICDQERF      1 - 70
QVKNPPHTYIQKLKGYLDPAVTRKKFRRRVQESTQVLRELEISLRTNHIGWVREFLNEENKGLDVLVEYL     71 - 140
SFAQYAVTFDFESVESTVESSVDKSKPWSRSIEDLHRGSNLPSPVGNSVSRSGRHSALRYNTLPSRRTLK    141 - 210
NSRLVSKKDDVHVCIMCLRAIMNYQYGFNMVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGH    211 - 280
EIILSAFDNFKEVCGEKQRFEKLMEHFRNEDNNIDFMVASMQFINIVVHSVEDMNFRVHLQYEFTKLGLD    281 - 350
EYLDKLKHTESDKLQVQIQAYLDNVFDVGALLEDAETKNAALERVEELEENISHLSEKLQDTENEAMSKI    351 - 420
VELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEKQGTIKIQKKGDGD    421 - 490
IAILPVVASGTLSMGSEVVAGNSVGPTMGAASSGPLPPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPP    491 - 560
PPPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPPLPGTSSPTVVFNSGLAAVKIKKPIKTKFRMPVFN    561 - 630
WVALKPNQINGTVFNEIDDERILEDLNVDEFEEIFKTKAQGPAIDLSSSKQKIPQKGSNKVTLLEANRAK    631 - 700
NLAITLRKAGKTADEICKAIHVFDLKTLPVDFVECLMRFLPTENEVKVLRLYERERKPLENLSDEDRFMM    701 - 770
QFSKIERLMQKMTIMAFIGNFAESIQMLTPQLHAIIAASVSIKSSQKLKKILEIILALGNYMNSSKRGAV    771 - 840
YGFKLQSLDLLLDTKSTDRKQTLLHYISNVVKEKYHQVSLFYNELHYVEKAAAVSLENVLLDVKELQRGM    841 - 910
DLTKREYTMHDHNTLLKEFILNNEGKLKKLQDDAKIAQDAFDDVVKYFGENPKTTPPSVFFPVFVRFVKA    911 - 980
YKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQQELIAELRRRQVKDNRHVYEGKDGA    981 - 1050
IEDIITVLKTVPFTARTAKRGSRFFCEPVLTEEYHY                                     1051 - 1086
//

Text Mined References (35)

PMID Year Title