Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession Q96PY0 Q8NAR8 Q8NBC0
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MMDCTWTLPGMRATWQPAPFLPWDQTPWRVSFSWSPVLLAWGGVWSGEAHPCAHVLRPPASPCPPRPRRG      1 - 70
CGDSGSSGMAQRAQAGSNQSRGKCGRDGRCPPRSSPGAPEAAERVESAETRGPGKSWILSPSSMSEPRRG     71 - 140
KARRSPGRRRHPHSSFPQASSPSSPSRRETIPQVQSSGVPGAMSPEQTLFSRSPRGLSHLGQSLCRTVKE    141 - 210
SEAQRGKTMPPGSHSPSGAGQGRTARKGPAREEIPSSDSSAKPSVYPHPHLTAT                    211 - 264
//

Publication (4)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11572484 2001 Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins.