Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.3e-04
medulloblastoma, large-cell 6241 1.4e-03

Expression

 Compartment GO Term (0)

AA Sequence

MMDCTWTLPGMRATWQPAPFLPWDQTPWRVSFSWSPVLLAWGGVWSGEAHPCAHVLRPPASPCPPRPRRG      1 - 70
CGDSGSSGMAQRAQAGSNQSRGKCGRDGRCPPRSSPGAPEAAERVESAETRGPGKSWILSPSSMSEPRRG     71 - 140
KARRSPGRRRHPHSSFPQASSPSSPSRRETIPQVQSSGVPGAMSPEQTLFSRSPRGLSHLGQSLCRTVKE    141 - 210
SEAQRGKTMPPGSHSPSGAGQGRTARKGPAREEIPSSDSSAKPSVYPHPHLTAT                    211 - 264
//

Text Mined References (4)

PMID Year Title