Property Summary

NCBI Gene PubMed Count 34
Grant Count 117
R01 Count 55
Funding $34,284,434.66
PubMed Score 511.64
PubTator Score 40.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.700 0.001
ependymoma -3.100 0.000
oligodendroglioma -1.600 0.000
glioblastoma -3.700 0.000
group 4 medulloblastoma -3.500 0.000
atypical teratoid / rhabdoid tumor -3.400 0.000
medulloblastoma, large-cell -2.700 0.019
primitive neuroectodermal tumor -1.900 0.040
pediatric high grade glioma -2.800 0.000
pilocytic astrocytoma -1.100 0.047
subependymal giant cell astrocytoma -2.151 0.050
psoriasis -1.500 0.001

Synonym

Accession Q96PX8 Q5U5I6 Q96SF9
Symbols TTM
LRRC12

Gene

PDB

4RCA   4RCW  

Gene RIF (23)

PMID Text
26317387 Data provide partial support for the implication of SLITRK1 in the pathogenesis of Tourette syndrome.
23990902 the N400I variant of SLITRK1 may have a role in obsessive-compulsive disorder
23528612 One of the few genes that has been linked to TS is the SLITRK1 (Slit and Trk-like 1) gene, where four variations have been suggested as possible disease-associated changes
23333760 The study of chromosomal aberrations in Tourette syndrome etiology has implicated multiple genes, with SLITRK1 being the most prominent example.
21458401 DM1 motoneuron/muscle cell cocultures showed alterations that are consistent with the known role of SLITRK genes in neurite outgrowth, neuritogenesis, and synaptogenesis; functional defects can be directly attributed to SLITRK misexpression.
20351724 The study of this study support that SLITRK1 var321 is association to Tourette syndrome.
19240061 Observational study of gene-disease association. (HuGE Navigator)
19018236 results provide no evidence for SLITRK1 playing a major role in Tourette disease
19018236 Observational study of gene-disease association. (HuGE Navigator)
18722020 We report the psychopathological features in a large Italian family with Gilles de la Tourette syndrome not linked to the SLITRK1 gene.
More...

AA Sequence

MLLWILLLETSLCFAAGNVTGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQRFTAPTSQFYHLFLHGNSL      1 - 70
TRLFPNEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKRLHINNNKIKSFRKQTFLGLDDLEYLQADFN     71 - 140
LLRDIDPGAFQDLNKLEVLILNDNLISTLPANVFQYVPITHLDLRGNRLKTLPYEEVLEQIPGIAEILLE    141 - 210
DNPWDCTCDLLSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRVDSSLPAPPAQEET    211 - 280
FAPGPLPTPFKTNGQEDHATPGSAPNGGTKIPGNWQIKIRPTAAIATGSSRNKPLANSLPCPGGCSCDHI    281 - 350
PGSGLKMNCNNRNVSSLADLKPKLSNVQELFLRDNKIHSIRKSHFVDYKNLILLDLGNNNIATVENNTFK    351 - 420
NLLDLRWLYMDSNYLDTLSREKFAGLQNLEYLNVEYNAIQLILPGTFNAMPKLRILILNNNLLRSLPVDV    421 - 490
FAGVSLSKLSLHNNYFMYLPVAGVLDQLTSIIQIDLHGNPWECSCTIVPFKQWAERLGSEVLMSDLKCET    491 - 560
PVNFFRKDFMLLSNDEICPQLYARISPTLTSHSKNSTGLAETGTHSNSYLDTSRVSISVLVPGLLLVFVT    561 - 630
SAFTVVGMLVFILRNRKRSKRRDANSSASEINSLQTVCDSSYWHNGPYNADGAHRVYDCGSHSLSD        631 - 696
//

Text Mined References (33)

PMID Year Title
26317387 2015 Analysis of SLITRK1 in Japanese patients with Tourette syndrome using a next-generation sequencer.
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
23990902 2013 Characterization of SLITRK1 variation in obsessive-compulsive disorder.
23528612 2013 Sequence analysis of SLITRK1 for var321 in Danish patients with Tourette syndrome and review of the literature.
23333760 2013 The genetic basis of Gilles de la Tourette Syndrome.
23326512 2013 Genome-wide association study of irritable vs. elated mania suggests genetic differences between clinical subtypes of bipolar disorder.
22365631 2012 Genome-wide association study of temperament in bipolar disorder reveals significant associations with three novel Loci.
21458401 2011 Mutant human embryonic stem cells reveal neurite and synapse formation defects in type 1 myotonic dystrophy.
20351724 2010 Additional support for the association of SLITRK1 var321 and Tourette syndrome.
More...