Property Summary

NCBI Gene PubMed Count 36
PubMed Score 555.50
PubTator Score 40.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -2.600 7.9e-04
astrocytic glioma -1.700 1.3e-03
atypical teratoid / rhabdoid tumor -3.400 9.6e-05
ependymoma -2.300 1.6e-02
glioblastoma -2.700 2.8e-05
group 4 medulloblastoma -3.500 3.5e-05
medulloblastoma, large-cell -2.700 1.9e-02
oligodendroglioma -1.200 4.8e-03
Pilocytic astrocytoma -1.100 4.7e-02
primitive neuroectodermal tumor -1.900 4.0e-02
psoriasis -1.500 1.4e-03
subependymal giant cell astrocytoma -2.151 5.0e-02

Gene RIF (23)

AA Sequence

MLLWILLLETSLCFAAGNVTGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQRFTAPTSQFYHLFLHGNSL      1 - 70
TRLFPNEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKRLHINNNKIKSFRKQTFLGLDDLEYLQADFN     71 - 140
LLRDIDPGAFQDLNKLEVLILNDNLISTLPANVFQYVPITHLDLRGNRLKTLPYEEVLEQIPGIAEILLE    141 - 210
DNPWDCTCDLLSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRVDSSLPAPPAQEET    211 - 280
FAPGPLPTPFKTNGQEDHATPGSAPNGGTKIPGNWQIKIRPTAAIATGSSRNKPLANSLPCPGGCSCDHI    281 - 350
PGSGLKMNCNNRNVSSLADLKPKLSNVQELFLRDNKIHSIRKSHFVDYKNLILLDLGNNNIATVENNTFK    351 - 420
NLLDLRWLYMDSNYLDTLSREKFAGLQNLEYLNVEYNAIQLILPGTFNAMPKLRILILNNNLLRSLPVDV    421 - 490
FAGVSLSKLSLHNNYFMYLPVAGVLDQLTSIIQIDLHGNPWECSCTIVPFKQWAERLGSEVLMSDLKCET    491 - 560
PVNFFRKDFMLLSNDEICPQLYARISPTLTSHSKNSTGLAETGTHSNSYLDTSRVSISVLVPGLLLVFVT    561 - 630
SAFTVVGMLVFILRNRKRSKRRDANSSASEINSLQTVCDSSYWHNGPYNADGAHRVYDCGSHSLSD        631 - 696
//

Text Mined References (36)

PMID Year Title