Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q96PW8
Symbols

Gene

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MFTLLDVVNCKARFIHDGPEDTSDQLVLEVSVMAWLPMPSCLRRGQTDLLPIQVNPVNDPPHIIFPHGSL      1 - 70
MVILEHTQKPLGPEVLQAYDLDSACEGLAFQLLGTPSGLPVDHRDQPGEPVTEFSCWELEAGSLVYVHCG     71 - 140
GPTQDLTFRVSNGLQASPPAMLKVVAVQLAIQIHRSTGLHLAQGSAMPILPTNLLVETSAVGQDVTVLFH    141 - 210
VTGGLPFRELQKQGAGGVEDAEWWVTQAFHQQDVEQGHVRYRSTDPQHYTEDTVENLDLQVQVSWEILSN    211 - 280
LSFLVTIQRATVWMLQLEPLHTQNTQQEALTTAHLEATLEEAGPSPPTFHCEVVQAPRKGNFQLQGTMLS    281 - 350
DGQGFTQDDVQAAEVTYGAMARASVAVEDTFCFHVTAPPYFSPLCTFSIHIGGDPDMPVLTNVLVVPEGG    351 - 420
GCVLSADQLFVKSLNSARYLYEVM                                                  421 - 444
//

Text Mined References (2)

PMID Year Title
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
11572484 2001 Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins.