Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma 1.400 3.7e-02
Breast cancer -1.200 4.0e-06
ependymoma 2.400 5.7e-03
oligodendroglioma 1.200 3.2e-02
osteosarcoma -3.927 3.7e-08
pancreatic ductal adenocarcinoma liver m... 1.295 2.9e-03
Pick disease -2.200 8.8e-06
progressive supranuclear palsy -1.800 9.6e-03

 Compartment GO Term (1)

AA Sequence

MAANVGDQRSTDWSSQYSMVAGAGRENGMETPMHENPEWEKARQALASISKSGAAGGSAKSSSNGPVASA      1 - 70
QYVSQAEASALQQQQYYQWYQQYNYAYPYSYYYPMPPVPGMDESMSYQAPPQQLPSAQPPQPSNPPHGAH     71 - 140
TLNSGPQPGTAPATQHSQAGPATGQAYGPHTYTEPAKPKKGQQLWNRMKPAPGTGGLKFNIQKRPFAVTT    141 - 210
QSFGSNAEGQHSGFGPQPNPEKVQNHSGSSARGNLSGKPDDWPQDMKEYVERCFTACESEEDKDRTEKLL    211 - 280
KEVLQARLQDGSAYTIDWSREPLPGLTREPVAESPKKKRWEAASSLHPPRGAGSATRGGGAPSQRGTPGA    281 - 350
GGAGRARGNSFTKFGNRNVFMKDNSSSSSTDSRSRSSSRSPTRHFRRSDSHSDSDSSYSGNECHPVGRRN    351 - 420
PPPKGRGGRGAHMDRGRGRAQRGKRHDLAPTKRSRKKMAALECEDPERELKKQKRAARFQHGHSRRLRLE    421 - 490
PLVLQMSSLESSGADPDWQELQIVGTCPDITKHYLRLTCAPDPSTVRPVAVLKKSLCMVKCHWKEKQDYA    491 - 560
FACEQMKSIRQDLTVQGIRTEFTVEVYETHARIALEKGDHEEFNQCQTQLKSLYAENLPGNVGEFTAYRI    561 - 630
LYYIFTKNSGDITTELAYLTRELKADPCVAHALALRTAWALGNYHRFFRLYCHAPCMSGYLVDKFADRER    631 - 700
KVALKAMIKTYVVPSSLLPLLFPSFRLVSSCIKLSPCPLLPLPPVFLLIFFSPFPPSLSAFFPWFSTGKT    701 - 770
VPLPPSSAM                                                                 771 - 779
//

Text Mined References (16)

PMID Year Title