Property Summary

NCBI Gene PubMed Count 59
Grant Count 16
R01 Count 14
Funding $1,226,492.55
PubMed Score 63.65
PubTator Score 55.30

Knowledge Summary

Patent

No data available

Expression

Gene RIF (36)

PMID Text
27029405 QKI has a role in posttranscriptionally guiding macrophage identity and function.
26926106 QKI-7 recruits PAPD4 to regulate post-transcriptional polyadenylation of target mRNAs.
26829751 MYB-QKI rearrangements promote tumorigenesis through three mechanisms: MYB activation by truncation, enhancer translocation driving aberrant MYB-QKI expression and hemizygous loss of the tumor suppressor QKI
26337206 Data implicate QKI in the pathophysiology of inflammation and leukemoogenesis where miR-155 is involved.
26056009 miR-29a promotes scavenger receptor A expression by targeting QKI during monocyte-macrophage differentiation.
25768908 Using circScreen, study identified the RNA binding protein Quaking (QKI) as a major regulator of circRNA biogenesis in epithelial-mesenchymal transition (EMT) and show that introduction of consensus binding sequences for QKI into the flanking introns is sufficient to cause circRNAs to be produced from exons that normally only undergo canonical linear splicing.
25420938 miR-155 regulates the cell cycle and invasion ability of colon cancer cells via the modulation of QKI expression
24918581 QKI is a novel Cancer stem cells (CSC) inhibitor and impaired multiple oral CSC properties via partial repression of SOX2.
24722255 QKI as a key regulator of alternative splicing in lung cancer.
24398626 QKI-mediated repression of FOXO1 may be one of the factors contributing to the oncogenesis and progression of breast carcinoma.
More...

AA Sequence

MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSA      1 - 70
ELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRG     71 - 140
KPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIK    141 - 210
SPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPE    211 - 280
AGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN             281 - 341
//

Text Mined References (65)

PMID Year Title
27029405 2016 Quaking promotes monocyte differentiation into pro-atherogenic macrophages by controlling pre-mRNA splicing and gene expression.
26926106 2016 The STAR protein QKI-7 recruits PAPD4 to regulate post-transcriptional polyadenylation of target mRNAs.
26829751 2016 MYB-QKI rearrangements in angiocentric glioma drive tumorigenicity through a tripartite mechanism.
26337206 2015 Quaking and miR-155 interactions in inflammation and leukemogenesis.
26056009 2015 miR-29a promotes scavenger receptor A expression by targeting QKI (quaking) during monocyte-macrophage differentiation.
25768908 2015 The RNA binding protein quaking regulates formation of circRNAs.
25420938 2015 MicroRNA-155 promotes the proliferation and invasion abilities of colon cancer cells by targeting quaking.
25416956 2014 A proteome-scale map of the human interactome network.
24918581 2014 QKI impairs self-renewal and tumorigenicity of oral cancer cells via repression of SOX2.
24722255 2014 The RNA-binding protein QKI suppresses cancer-associated aberrant splicing.
More...