Property Summary

NCBI Gene PubMed Count 67
PubMed Score 75.12
PubTator Score 55.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Glioma 74 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Ganglioglioma 13 3.141 1.6

Expression

  Differential Expression (38)

Disease log2 FC p
acute quadriplegic myopathy 1.168 2.4e-04
adult high grade glioma 1.400 2.6e-04
aldosterone-producing adenoma -1.086 2.4e-02
astrocytic glioma 1.500 4.5e-02
Astrocytoma, Pilocytic 1.600 9.6e-07
atypical teratoid / rhabdoid tumor 1.500 2.0e-05
Breast cancer -1.200 2.5e-06
colon cancer -1.400 4.4e-02
dermatomyositis 1.600 5.5e-04
Down syndrome 1.100 6.1e-04
ductal carcinoma in situ -1.300 5.2e-03
ependymoma 2.000 8.8e-03
gastric carcinoma 1.400 1.0e-02
glioblastoma 1.200 1.2e-04
group 3 medulloblastoma -2.800 1.7e-07
hereditary spastic paraplegia -1.110 1.2e-02
interstitial cystitis 1.100 7.1e-05
intraductal papillary-mucinous adenoma (... -1.400 3.4e-02
intraductal papillary-mucinous carcinoma... -1.700 1.5e-02
invasive ductal carcinoma -1.300 1.3e-02
lung adenocarcinoma -2.000 5.2e-13
lung cancer -1.400 3.9e-03
lung carcinoma -2.000 3.4e-31
malignant mesothelioma 1.600 2.8e-05
medulloblastoma, large-cell -4.700 4.6e-06
Multiple myeloma 1.300 1.7e-02
non-small cell lung cancer -2.084 9.0e-23
oligodendroglioma 1.500 1.6e-02
osteosarcoma 3.300 5.0e-10
ovarian cancer -1.800 6.4e-07
pancreatic cancer 1.100 3.6e-03
Pick disease -1.200 3.7e-03
primary Sjogren syndrome 1.300 1.9e-03
primitive neuroectodermal tumor 1.300 1.6e-03
progressive supranuclear palsy -1.200 4.3e-03
Rheumatoid arthritis 1.600 3.2e-03
subependymal giant cell astrocytoma 1.580 1.7e-02
ulcerative colitis 1.700 3.8e-05

Protein-protein Interaction (4)

Gene RIF (43)

AA Sequence

MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSA      1 - 70
ELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRG     71 - 140
KPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIK    141 - 210
SPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPE    211 - 280
AGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN             281 - 341
//

Text Mined References (73)

PMID Year Title