Property Summary

NCBI Gene PubMed Count 59
PubMed Score 63.65
PubTator Score 55.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 3.36941596242062E-31
non-small cell lung cancer 2798 9.01040896495845E-23
pilocytic astrocytoma 3086 3.29284773927008E-10
group 4 medulloblastoma 1875 3.37380537352779E-10
osteosarcoma 7933 5.03979080881061E-10
ulcerative colitis 2087 1.19163346898047E-8
ovarian cancer 8492 2.18455034520788E-8
pediatric high grade glioma 2712 1.83988555346915E-7
malignant mesothelioma 3163 2.01390378314929E-7
atypical teratoid/rhabdoid tumor 1095 2.81494803741088E-7
primitive neuroectodermal tumor 3031 8.99093520833497E-7
glioblastoma 5572 1.70854500179213E-6
lung adenocarcinoma 2714 2.34392628791951E-6
medulloblastoma, large-cell 6234 4.58319087447207E-6
Breast cancer 3099 6.65338357484942E-6
lung cancer 4473 2.70585943752391E-5
interstitial cystitis 2299 7.08324332771444E-5
acute quadriplegic myopathy 1157 2.43984016073229E-4
ductal carcinoma in situ 1745 3.04822267249726E-4
dermatomyositis 967 5.4736531600191E-4
Down syndrome 548 7.94919497166627E-4
Multiple myeloma 1328 8.01918237722073E-4
invasive ductal carcinoma 2950 0.00104522292551838
primary Sjogren syndrome 789 0.00192741286147174
Rheumatoid Arthritis 1171 0.00322939023081678
pancreatic cancer 2300 0.00357096741109624
Pick disease 1893 0.00371433619306873
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00663263974181637
ependymoma 2514 0.0088237624733922
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00922977011148826
colon cancer 1475 0.0101310123101464
gastric carcinoma 832 0.0104237051908053
hereditary spastic paraplegia 313 0.0122299352275393
progressive supranuclear palsy 674 0.0157590677324987
subependymal giant cell astrocytoma 2287 0.0168489850706779
oligodendroglioma 2849 0.0177377745424028
aldosterone-producing adenoma 664 0.0237133461464202
astrocytic glioma 2241 0.0245386756953918
Disease Target Count Z-score Confidence
Schizophrenia 503 3.6 1.8
Ganglioglioma 16 3.197 1.6

Expression

Gene RIF (36)

PMID Text
27029405 QKI has a role in posttranscriptionally guiding macrophage identity and function.
26926106 QKI-7 recruits PAPD4 to regulate post-transcriptional polyadenylation of target mRNAs.
26829751 MYB-QKI rearrangements promote tumorigenesis through three mechanisms: MYB activation by truncation, enhancer translocation driving aberrant MYB-QKI expression and hemizygous loss of the tumor suppressor QKI
26337206 Data implicate QKI in the pathophysiology of inflammation and leukemoogenesis where miR-155 is involved.
26056009 miR-29a promotes scavenger receptor A expression by targeting QKI during monocyte-macrophage differentiation.
25768908 Using circScreen, study identified the RNA binding protein Quaking (QKI) as a major regulator of circRNA biogenesis in epithelial-mesenchymal transition (EMT) and show that introduction of consensus binding sequences for QKI into the flanking introns is sufficient to cause circRNAs to be produced from exons that normally only undergo canonical linear splicing.
25420938 miR-155 regulates the cell cycle and invasion ability of colon cancer cells via the modulation of QKI expression
24918581 QKI is a novel Cancer stem cells (CSC) inhibitor and impaired multiple oral CSC properties via partial repression of SOX2.
24722255 QKI as a key regulator of alternative splicing in lung cancer.
24398626 QKI-mediated repression of FOXO1 may be one of the factors contributing to the oncogenesis and progression of breast carcinoma.
More...

AA Sequence

MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSA      1 - 70
ELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRG     71 - 140
KPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIK    141 - 210
SPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPE    211 - 280
AGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN             281 - 341
//

Text Mined References (65)

PMID Year Title
27029405 2016 Quaking promotes monocyte differentiation into pro-atherogenic macrophages by controlling pre-mRNA splicing and gene expression.
26926106 2016 The STAR protein QKI-7 recruits PAPD4 to regulate post-transcriptional polyadenylation of target mRNAs.
26829751 2016 MYB-QKI rearrangements in angiocentric glioma drive tumorigenicity through a tripartite mechanism.
26337206 2015 Quaking and miR-155 interactions in inflammation and leukemogenesis.
26056009 2015 miR-29a promotes scavenger receptor A expression by targeting QKI (quaking) during monocyte-macrophage differentiation.
25768908 2015 The RNA binding protein quaking regulates formation of circRNAs.
25420938 2015 MicroRNA-155 promotes the proliferation and invasion abilities of colon cancer cells by targeting quaking.
25416956 2014 A proteome-scale map of the human interactome network.
24918581 2014 QKI impairs self-renewal and tumorigenicity of oral cancer cells via repression of SOX2.
24722255 2014 The RNA-binding protein QKI suppresses cancer-associated aberrant splicing.
More...