Property Summary

NCBI Gene PubMed Count 144
PubMed Score 353.86
PubTator Score 196.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical carcinoma -1.091 4.3e-03
adult high grade glioma -2.000 1.1e-04
astrocytic glioma -1.400 6.4e-03
Astrocytoma, Pilocytic -1.600 8.9e-06
atypical teratoid / rhabdoid tumor -2.400 2.0e-04
Breast cancer -1.600 1.9e-09
colon cancer -2.000 3.2e-03
cystic fibrosis 1.286 2.7e-04
ductal carcinoma in situ -1.200 3.3e-02
ependymoma -1.200 3.1e-02
glioblastoma -2.300 3.9e-07
interstitial cystitis -2.100 2.1e-03
interstitial lung disease -1.400 1.2e-02
invasive ductal carcinoma -1.500 2.1e-02
lung adenocarcinoma -1.300 1.5e-08
lung cancer -2.700 2.1e-04
malignant mesothelioma -1.500 8.1e-07
medulloblastoma -1.300 1.3e-02
medulloblastoma, large-cell -1.900 2.3e-04
Multiple myeloma 1.488 2.1e-02
non-small cell lung cancer -1.928 8.7e-21
oligodendroglioma -1.100 2.3e-02
ovarian cancer -1.500 1.4e-10
psoriasis -2.700 7.9e-04
spina bifida -1.531 4.5e-02
ulcerative colitis -1.110 1.5e-02

Protein-protein Interaction (3)

Gene RIF (113)

AA Sequence

MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTL      1 - 70
NPKWNEEFYFRVNPSNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPTEDPTMERPYTFKDFLLRPRSHKS     71 - 140
RVKGFLRLKMAYMPKNGGQDEENSDQRDDMEHGWEVVDSNDSASQHQEELPPPPLPPGWEEKVDNLGRTY    141 - 210
YVNHNNRTTQWHRPSLMDVSSESDNNIRQINQEAAHRRFRSRRHISEDLEPEPSEGGDVPEPWETISEEV    211 - 280
NIAGDSLGLALPPPPASPGSRTSPQELSEELSRRLQITPDSNGEQFSSLIQREPSSRLRSCSVTDAVAEQ    281 - 350
GHLPPPSAPAGRARSSTVTGGEEPTPSVAYVHTTPGLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIMQL    351 - 420
AEDGASGSATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKP    421 - 490
QHKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVHMRSKTSLNPNDLGPLPPGWEERIHL    491 - 560
DGRTFYIDHNSKITQWEDPRLQNPAITGPAVPYSREFKQKYDYFRKKLKKPADIPNRFEMKLHRNNIFEE    561 - 630
SYRRIMSVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSG    631 - 700
LCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTE    701 - 770
LDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLI    771 - 840
KIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPM    841 - 910
NGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFEGVD         911 - 975
//

Text Mined References (162)

PMID Year Title