Property Summary

NCBI Gene PubMed Count 135
Grant Count 149
R01 Count 99
Funding $11,036,109.62
PubMed Score 312.71
PubTator Score 196.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
interstitial lung disease -1.400 0.012
Multiple myeloma 1.488 0.021
malignant mesothelioma -1.500 0.000
astrocytoma -2.100 0.000
ependymoma -2.700 0.000
oligodendroglioma -2.100 0.000
psoriasis -2.700 0.001
glioblastoma -2.800 0.000
cystic fibrosis 1.347 0.000
atypical teratoid / rhabdoid tumor -2.700 0.003
medulloblastoma -1.300 0.013
medulloblastoma, large-cell -1.900 0.000
ulcerative colitis -1.800 0.000
adrenocortical carcinoma -1.366 0.000
non-small cell lung cancer -2.598 0.000
lung cancer -2.700 0.000
colon cancer -2.000 0.003
interstitial cystitis -3.400 0.000
lung adenocarcinoma -2.500 0.000
pediatric high grade glioma -2.300 0.000
pilocytic astrocytoma -4.100 0.000
Breast cancer -2.500 0.000
spina bifida -1.531 0.045
ductal carcinoma in situ -1.200 0.033
invasive ductal carcinoma -1.500 0.021
ovarian cancer -2.500 0.000

Synonym

Accession Q96PU5 O43165 Q3LSM7 Q7Z5F1 Q7Z5F2 Q7Z5N3 Q8N5A7 Q8WUU9 Q9BW58 Q9H2W4 Q9NT88
Symbols RSP5
PVNH7
NEDD4-2
NEDD4.2
hNEDD4-2

Gene

PANTHER Protein Class (2)

PDB

2LAJ   2LB2   2LTY   2MPT   2NSQ   2ONI   3JVZ   3JW0   5HPK  

Gene RIF (115)

PMID Text
26740304 Overexpression of Nedd4-2 enhanced hOAT4 ubiquitination, and inhibited hOAT4 transport activity.
26608079 Propose regulation of placental SNAT2/LAT1 ubiquitination by mTORC1 and Nedd4-2.
26363003 Data show that membrane protein Ndfip1 recruits E3 ubiquitin (Ub) ligase Nedd4-2 to the Golgi to target ether-a-go-go-related gene (hERG) channel for degradation while membrane protein Ndfip2 also mediates Nedd4-2 interaction with hERG in the Golgi.
26130719 DDB2 can bind to the promoter region of NEDD4L and recruit enhancer of zeste homolog 2 histone methyltransferase to repress NEDD4L transcription by enhancing histone H3 lysine 27 trimethylation at the NEDD4L promoter.
25785312 Proteomics analysis of EV71-infected cells reveals the involvement of host protein NEDD4L in EV71 replication.
25633977 Angiomotin (AMOT) stimulates NEDD4L-dependent release of HIV-1 Gag delta PTAP/YP in a does-dependent manner in 293T cells
25633977 Angiomotin (AMOT) stimulates NEDD4L-dependent release of HIV-1 Gag delta PTAP/YP in a does-dependent manner in 293T cells
25542253 Our results suggest that three screened NEDD4-2 variants do not play a leading role in the pathogenesis of photosensitive epilepsy in the Turkish population.
25295397 The mechanisms of activation and degradation of the NEDD4L:the transition from the closed to the active form is regulated by a competition of inositol 1,4,5-trisphosphate and Ca2+.
24831004 Human NHE3, but not non-primates NHE3s, is ubiquitinated by Nedd4-2.
More...

AA Sequence

MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTL      1 - 70
NPKWNEEFYFRVNPSNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPTEDPTMERPYTFKDFLLRPRSHKS     71 - 140
RVKGFLRLKMAYMPKNGGQDEENSDQRDDMEHGWEVVDSNDSASQHQEELPPPPLPPGWEEKVDNLGRTY    141 - 210
YVNHNNRTTQWHRPSLMDVSSESDNNIRQINQEAAHRRFRSRRHISEDLEPEPSEGGDVPEPWETISEEV    211 - 280
NIAGDSLGLALPPPPASPGSRTSPQELSEELSRRLQITPDSNGEQFSSLIQREPSSRLRSCSVTDAVAEQ    281 - 350
GHLPPPSAPAGRARSSTVTGGEEPTPSVAYVHTTPGLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIMQL    351 - 420
AEDGASGSATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKP    421 - 490
QHKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVHMRSKTSLNPNDLGPLPPGWEERIHL    491 - 560
DGRTFYIDHNSKITQWEDPRLQNPAITGPAVPYSREFKQKYDYFRKKLKKPADIPNRFEMKLHRNNIFEE    561 - 630
SYRRIMSVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSG    631 - 700
LCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTE    701 - 770
LDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLI    771 - 840
KIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPM    841 - 910
NGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFEGVD         911 - 975
//

Publication (153)

PMID Year Title
26740304 2016 Serum- and glucocorticoid-inducible kinase SGK2 regulates human organic anion transporters 4 via ubiquitin ligase Nedd4-2.
26608079 2016 Regulation of amino acid transporter trafficking by mTORC1 in primary human trophoblast cells is mediated by the ubiquitin ligase Nedd4-2.
26363003 2015 Regulation of the human ether-a-go-go-related gene (hERG) potassium channel by Nedd4 family interacting proteins (Ndfips).
26130719 2015 DDB2 modulates TGF-? signal transduction in human ovarian cancer cells by downregulating NEDD4L.
25785312 2015 Proteomics analysis of EV71-infected cells reveals the involvement of host protein NEDD4L in EV71 replication.
25631046 2015 Nedd4 family interacting protein 1 (Ndfip1) is required for ubiquitination and nuclear trafficking of BRCA1-associated ATM activator 1 (BRAT1) during the DNA damage response.
25542253 2015 Investigation of the possible association of NEDD4-2 (NEDD4L) gene with idiopathic photosensitive epilepsy.
25416956 2014 A proteome-scale map of the human interactome network.
25295397 2014 Structural basis of the activation and degradation mechanisms of the E3 ubiquitin ligase Nedd4L.
24831004 2014 Unique regulation of human Na+/H+ exchanger 3 (NHE3) by Nedd4-2 ligase that differs from non-primate NHE3s.
More...