Property Summary

NCBI Gene PubMed Count 135
PubMed Score 312.71
PubTator Score 196.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
non-small cell lung cancer 2798 5.27626544061978E-25
astrocytoma 1493 1.0681640792333E-19
lung adenocarcinoma 2714 4.97008482958875E-17
oligodendroglioma 2849 7.65153635432369E-14
ovarian cancer 8492 8.83578621673832E-13
ependymoma 2514 4.6876545144912E-12
pilocytic astrocytoma 3086 1.27091949484891E-10
Breast cancer 3099 2.15468731958818E-7
malignant mesothelioma 3163 8.10196414670797E-7
interstitial cystitis 2299 1.02012114240836E-5
adrenocortical carcinoma 1427 1.63227252709768E-5
pediatric high grade glioma 2712 1.71960459993683E-5
cystic fibrosis 1670 4.79003149817673E-5
glioblastoma 5572 7.12481867856746E-5
lung cancer 4473 2.10565012561486E-4
medulloblastoma, large-cell 6234 2.31688575181362E-4
ulcerative colitis 2087 4.91929830890304E-4
psoriasis 6685 7.9067146275632E-4
atypical teratoid / rhabdoid tumor 4369 0.00269032453976285
colon cancer 1475 0.00317139221265179
interstitial lung disease 292 0.011926851249923
medulloblastoma 1524 0.0129000946520232
invasive ductal carcinoma 2950 0.0209536878637672
Multiple myeloma 1328 0.0212587894803669
ductal carcinoma in situ 1745 0.0334075944808709
spina bifida 1064 0.0450154860830425
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Liddle syndrome 14 6.049 3.0
Hypertension 293 4.248 2.1
Long QT syndrome 53 3.032 1.5

Expression

  Differential Expression (26)

Disease log2 FC p
interstitial lung disease -1.400 0.012
Multiple myeloma 1.488 0.021
malignant mesothelioma -1.500 0.000
astrocytoma -2.100 0.000
ependymoma -2.700 0.000
oligodendroglioma -2.100 0.000
psoriasis -2.700 0.001
glioblastoma -2.800 0.000
cystic fibrosis 1.347 0.000
atypical teratoid / rhabdoid tumor -2.700 0.003
medulloblastoma -1.300 0.013
medulloblastoma, large-cell -1.900 0.000
ulcerative colitis -1.800 0.000
adrenocortical carcinoma -1.366 0.000
non-small cell lung cancer -2.598 0.000
lung cancer -2.700 0.000
colon cancer -2.000 0.003
interstitial cystitis -3.400 0.000
lung adenocarcinoma -2.500 0.000
pediatric high grade glioma -2.300 0.000
pilocytic astrocytoma -4.100 0.000
Breast cancer -2.500 0.000
spina bifida -1.531 0.045
ductal carcinoma in situ -1.200 0.033
invasive ductal carcinoma -1.500 0.021
ovarian cancer -2.500 0.000

Synonym

Accession Q96PU5 O43165 Q3LSM7 Q7Z5F1 Q7Z5F2 Q7Z5N3 Q8N5A7 Q8WUU9 Q9BW58 Q9H2W4 Q9NT88
Symbols RSP5
PVNH7
NEDD4-2
NEDD4.2
hNEDD4-2

Gene

PANTHER Protein Class (2)

PDB

2LAJ   2LB2   2LTY   2MPT   2NSQ   2ONI   3JVZ   3JW0   5HPK  

  Ortholog (13)

Gene RIF (103)

PMID Text
26740304 Overexpression of Nedd4-2 enhanced hOAT4 ubiquitination, and inhibited hOAT4 transport activity.
26608079 Propose regulation of placental SNAT2/LAT1 ubiquitination by mTORC1 and Nedd4-2.
26363003 Data show that membrane protein Ndfip1 recruits E3 ubiquitin (Ub) ligase Nedd4-2 to the Golgi to target ether-a-go-go-related gene (hERG) channel for degradation while membrane protein Ndfip2 also mediates Nedd4-2 interaction with hERG in the Golgi.
26130719 DDB2 can bind to the promoter region of NEDD4L and recruit enhancer of zeste homolog 2 histone methyltransferase to repress NEDD4L transcription by enhancing histone H3 lysine 27 trimethylation at the NEDD4L promoter.
25785312 Proteomics analysis of EV71-infected cells reveals the involvement of host protein NEDD4L in EV71 replication.
25633977 Angiomotin (AMOT) stimulates NEDD4L-dependent release of HIV-1 Gag delta PTAP/YP in a does-dependent manner in 293T cells
25542253 Our results suggest that three screened NEDD4-2 variants do not play a leading role in the pathogenesis of photosensitive epilepsy in the Turkish population.
25295397 The mechanisms of activation and degradation of the NEDD4L:the transition from the closed to the active form is regulated by a competition of inositol 1,4,5-trisphosphate and Ca2+.
24831004 Human NHE3, but not non-primates NHE3s, is ubiquitinated by Nedd4-2.
24657276 glucocorticoid stimulation therefore appears to allow cAMP-dependent control of Na(+) absorption by facilitating the effects of PKA upon the Nedd4-2
More...

AA Sequence

MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTL      1 - 70
NPKWNEEFYFRVNPSNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPTEDPTMERPYTFKDFLLRPRSHKS     71 - 140
RVKGFLRLKMAYMPKNGGQDEENSDQRDDMEHGWEVVDSNDSASQHQEELPPPPLPPGWEEKVDNLGRTY    141 - 210
YVNHNNRTTQWHRPSLMDVSSESDNNIRQINQEAAHRRFRSRRHISEDLEPEPSEGGDVPEPWETISEEV    211 - 280
NIAGDSLGLALPPPPASPGSRTSPQELSEELSRRLQITPDSNGEQFSSLIQREPSSRLRSCSVTDAVAEQ    281 - 350
GHLPPPSAPAGRARSSTVTGGEEPTPSVAYVHTTPGLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIMQL    351 - 420
AEDGASGSATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKP    421 - 490
QHKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVHMRSKTSLNPNDLGPLPPGWEERIHL    491 - 560
DGRTFYIDHNSKITQWEDPRLQNPAITGPAVPYSREFKQKYDYFRKKLKKPADIPNRFEMKLHRNNIFEE    561 - 630
SYRRIMSVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSG    631 - 700
LCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTE    701 - 770
LDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLI    771 - 840
KIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPM    841 - 910
NGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFEGVD         911 - 975
//

Text Mined References (153)

PMID Year Title
26740304 2016 Serum- and glucocorticoid-inducible kinase SGK2 regulates human organic anion transporters 4 via ubiquitin ligase Nedd4-2.
26608079 2016 Regulation of amino acid transporter trafficking by mTORC1 in primary human trophoblast cells is mediated by the ubiquitin ligase Nedd4-2.
26363003 2015 Regulation of the human ether-a-go-go-related gene (hERG) potassium channel by Nedd4 family interacting proteins (Ndfips).
26130719 2015 DDB2 modulates TGF-? signal transduction in human ovarian cancer cells by downregulating NEDD4L.
25785312 2015 Proteomics analysis of EV71-infected cells reveals the involvement of host protein NEDD4L in EV71 replication.
25631046 2015 Nedd4 family interacting protein 1 (Ndfip1) is required for ubiquitination and nuclear trafficking of BRCA1-associated ATM activator 1 (BRAT1) during the DNA damage response.
25542253 2015 Investigation of the possible association of NEDD4-2 (NEDD4L) gene with idiopathic photosensitive epilepsy.
25416956 2014 A proteome-scale map of the human interactome network.
25295397 2014 Structural basis of the activation and degradation mechanisms of the E3 ubiquitin ligase Nedd4L.
24831004 2014 Unique regulation of human Na+/H+ exchanger 3 (NHE3) by Nedd4-2 ligase that differs from non-primate NHE3s.
More...