Property Summary

NCBI Gene PubMed Count 25
PubMed Score 36.60
PubTator Score 33.56

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 3.36987686181231E-13
ovarian cancer 8492 1.60965986357611E-7
primary pancreatic ductal adenocarcinoma 1271 0.0161154788558845
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 0.0 1.0


  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis 1.153 0.000
primary pancreatic ductal adenocarcinoma 1.016 0.016
ovarian cancer -1.800 0.000


Accession Q96PU4 Q5VYR1 Q5VYR3 Q659C8 Q8TAG7
Symbols NIRF


PANTHER Protein Class (2)


1WY8   1Z6U   2E6S   3OLN   4PW5   4PW6   4PW7   4TVR  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (19)

24813944 A hydrogen bond between the hydroxyl group of 5hmC and UHRF2-SRA is critical for their preferential binding.
24573556 UHRF2 may contribute to the progression of colon carcinogenesis and function as a novel prognostic indicator after curative operation
23833190 UHRF2 is a transcriptional target of E2F, that it directly interacts with E2F1.
23537643 UHRF2, the homolog of UHRF1, interacts with N-methylpurine DNA glycosylase (MPG) in cancer cells.
23404503 UHRF2, a ubiquitin E3 ligase, acts as a small ubiquitin-like modifier E3 ligase for zinc finger protein 131
23244124 Low UHRF2 mRNA expression is associated with malignant glioma.
22673569 NIRF may contribute to the coupling between the cell cycle network and the epigenetic landscape
22072112 In the present study, ubiquitin ligase, NIRF, binds to hepatitis B virus core protein and leads to the proteasome-mediated degradation of hepatitis B virus core protein in vivo.
22018986 NIRF is frequently upregulated in colorectal cancer and its oncogenicity can be suppressed by let-7a microRNA.
21952639 NIRF is immediately adjacent to the single nucleotide polymorphism rs719725, which is reportedly associated with the risk of colorectal cancer.

AA Sequence

CRHDLGQNYIMIPNEILQTLLDLFFPGYSKGR                                          771 - 802

Text Mined References (30)

PMID Year Title
24813944 2014 Structural basis for hydroxymethylcytosine recognition by the SRA domain of UHRF2.
24573556 2014 Ubiquitin-like with PHD and ring finger domains 2 is a predictor of survival and a potential therapeutic target in colon cancer.
23833190 2013 The nuclear protein UHRF2 is a direct target of the transcription factor E2F1 in the induction of apoptosis.
23537643 2013 Identification of UHRF1/2 as new N-methylpurine DNA glycosylase-interacting proteins.
23404503 2013 UHRF2, a ubiquitin E3 ligase, acts as a small ubiquitin-like modifier E3 ligase for zinc finger protein 131.
23244124 2012 UHRF2 mRNA expression is low in malignant glioma but silencing inhibits the growth of U251 glioma cells in vitro.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
22673569 2012 NIRF/UHRF2 occupies a central position in the cell cycle network and allows coupling with the epigenetic landscape.
22072112 2012 NIRF, a novel ubiquitin ligase, interacts with hepatitis B virus core protein and promotes its degradation.