Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

AA Sequence

MPAEVHGSPPASLCPCPSVKFRPGLPAMALLTALDDTLPEEAQGPGRRMILLSTPSQSDALRACFERNLY      1 - 70
PGIATKEQLAQGIDIPEPRVQIWFQNERSCQLRQHRRQSRPWPGRRDPQKGRRKRTAITGSQTALLLRAF     71 - 140
EKDRFPGIPAREELARETGLPESRIQLWFQNRRARHWGQSGRAPTQASIRCNAAPIG                 141 - 197
//

Text Mined References (1)

PMID Year Title
11245978 2001 Active genes in junk DNA? Characterization of DUX genes embedded within 3.3 kb repeated elements.