Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MPAEVHGSPPASLCPCPSVKFRPGLPAMALLTALDDTLPEEAQGPGRRMILLSTPSQSDALRACFERNLY      1 - 70
PGIATKEQLAQGIDIPEPRVQIWFQNERSCQLRQHRRQSRPWPGRRDPQKGRRKRTAITGSQTALLLRAF     71 - 140
EKDRFPGIPAREELARETGLPESRIQLWFQNRRARHWGQSGRAPTQASIRCNAAPIG                 141 - 197
//

Text Mined References (1)

PMID Year Title