Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
15709750 Report shows that full-length DUX1 is actively transported into the nuclei of transfected C2C12 myoblasts, and that DUX1 homeodomains contain the signals required for this localization.

AA Sequence

MPAEVHGSPPASLCPCQSVKFRPGLPEMALLTALDDTLPEEAQGPGRRMILLSTPSQSDALRACFERNLY      1 - 70
PGIATKEELAQGIDIPEPRVQIWFQNERSCQLRQHRRQSRPWPGRRDPQKGRRKRTAITGSQTALLLRAF     71 - 140
EKDRFPGIAAREELARETGLPESRIQIWFQNRRARHRGQSGRAPTQASIRCNAAPIG                 141 - 197
//

Publication (4)

PMID Year Title
26816005 2016 Homologous Transcription Factors DUX4 and DUX4c Associate with Cytoplasmic Proteins during Muscle Differentiation.
15709750 2005 Intracellular trafficking and dynamics of double homeodomain proteins.
11245978 2001 Active genes in junk DNA? Characterization of DUX genes embedded within 3.3 kb repeated elements.
9736770 1998 Characterization of a double homeodomain protein (DUX1) encoded by a cDNA homologous to 3.3 kb dispersed repeated elements.