Property Summary

NCBI Gene PubMed Count 40
PubMed Score 16.07
PubTator Score 18.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
pancreatic cancer 2398 5.9e-04
pancreatic carcinoma 562 5.9e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Pompholyx 4 4.458 2.2
Intestinal tuberculosis 5 3.862 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic cancer 1.200 5.9e-04
pancreatic carcinoma 1.200 5.9e-04

Gene RIF (13)

AA Sequence

MVFTQAPAEIMGHLRIRSLLARQCLAEFLGVFVLMLLTQGAVAQAVTSGETKGNFFTMFLAGSLAVTIAI      1 - 70
YVGGNVSGAHLNPAFSLAMCIVGRLPWVKLPIYILVQLLSAFCASGATYVLYHDALQNYTGGNLTVTGPK     71 - 140
ETASIFATYPAPYLSLNNGFLDQVLGTGMLIVGLLAILDRRNKGVPAGLEPVVVGMLILALGLSMGANCG    141 - 210
IPLNPARDLGPRLFTYVAGWGPEVFSAGNGWWWVPVVAPLVGATVGTATYQLLVALHHPEGPEPAQDLVS    211 - 280
AQHKASELETPASAQMLECKL                                                     281 - 301
//

Text Mined References (41)

PMID Year Title