Knowledge Summary

Patent

No data available

Synonym

Accession Q96PS6
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MIKHSWIHLYVMASAMSSSPIFFFFQRWSLTLSLRLECSSAIIKPTAASNSCVQVNLPPSMCDYRHEPLC      1 - 70
LAFL                                                                       71 - 74
//