Property Summary

NCBI Gene PubMed Count 9
Grant Count 14
R01 Count 11
Funding $1,535,990
PubMed Score 27.83
PubTator Score 10.84

Knowledge Summary

Patent (2,940)

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.100 0.026
ependymoma -1.300 0.014
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.300 0.000
medulloblastoma, large-cell -1.100 0.013
primitive neuroectodermal tumor -1.100 0.010
pediatric high grade glioma -1.100 0.000
pilocytic astrocytoma -1.100 0.000
Breast cancer -1.100 0.000

Gene RIF (4)

PMID Text
23628987 Kv3.2 is not different in distribution or in level between normal and schizophrenia cases, nor influenced by antipsychotic drugs, in any brain region tested
23475819 This family's complex phenotype is associated with a new chromosomal deletion, which suggests potential roles for the two genes, KCNC2 and ATXN7L3B, in human neurological disease.
21912965 Although all KV3 subunit transcripts are significantly expressed at embryonic age in whole brain extracts, only KV3.1, KV3.2 and KV3.4 subunit transgenic proteins are present.
19332619 In the absence of potassium ion, significant N-methyl-D-glucamine (NMDG)-positive currents could be recorded from human embryonic kidney cells expressing Kv3.1 or Kv3.2b channels and Kv1.5 Arg487Tyr/Val, but not wild-type channels.

AA Sequence

MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPPLSPPPRAPPL      1 - 70
SPGPGGCFEGGAGNCSSRGGRASDHPGGGREFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAF     71 - 140
WGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRR    141 - 210
LQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPVINGTSVVLQYEIETDP    211 - 280
ALTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVV    281 - 350
RFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQ    351 - 420
FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLP    421 - 490
RKRKKHIPPAPQASSPTFCKTELNMACNSTQSDTCLGKDNRLLEHNRSVLSGDDSTGSEPPLSPPERLPI    491 - 560
RRSSTRDKNRRGETCFLLTTGDYTCASDGGIRKGYEKSRSLNNIAGLAGNALRLSPVTSPYNSPCPLRRS    561 - 630
RSPIPSIL                                                                  631 - 638
//

Publication (14)

PMID Year Title
23628987 2014 Kv3.1-containing K(+) channels are reduced in untreated schizophrenia and normalized with antipsychotic drugs.
23475819 2013 Deletion of chromosome 12q21 affecting KCNC2 and ATXN7L3B in a family with neurodevelopmental delay and ataxia.
21912965 2012 Brain expression of Kv3 subunits during development, adulthood and aging and in a murine model of Alzheimer's disease.
19332619 2009 Control of voltage-gated K+ channel permeability to NMDG+ by a residue at the outer pore.
16541075 2006 The finished DNA sequence of human chromosome 12.
16382104 2005 International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15709110 2005 Stichodactyla helianthus peptide, a pharmacological tool for studying Kv3.2 channels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...