Property Summary

Ligand Count 3
NCBI Gene PubMed Count 9
PubMed Score 28.67
PubTator Score 10.84

Knowledge Summary

Patent (2,940)

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.100 2.6e-02
atypical teratoid / rhabdoid tumor -1.400 1.5e-07
Breast cancer -1.100 2.8e-05
ependymoma -1.300 1.4e-02
glioblastoma -1.300 1.7e-04
medulloblastoma, large-cell -1.100 1.3e-02
pediatric high grade glioma -1.100 3.1e-04
Pilocytic astrocytoma -1.100 1.7e-04
primitive neuroectodermal tumor -1.100 1.0e-02

Gene RIF (4)

AA Sequence

MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPPGDCLTTAGDKLQPSPPPLSPPPRAPPL      1 - 70
SPGPGGCFEGGAGNCSSRGGRASDHPGGGREFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAF     71 - 140
WGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRR    141 - 210
LQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPVINGTSVVLQYEIETDP    211 - 280
ALTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVV    281 - 350
RFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQ    351 - 420
FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLP    421 - 490
RKRKKHIPPAPQASSPTFCKTELNMACNSTQSDTCLGKDNRLLEHNRSVLSGDDSTGSEPPLSPPERLPI    491 - 560
RRSSTRDKNRRGETCFLLTTGDYTCASDGGIRKGYEKSRSLNNIAGLAGNALRLSPVTSPYNSPCPLRRS    561 - 630
RSPIPSIL                                                                  631 - 638
//

Text Mined References (14)

PMID Year Title