Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.92
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
acute myeloid leukemia 1.500 3.5e-02
astrocytic glioma 1.100 8.3e-03
atypical teratoid / rhabdoid tumor 1.300 1.0e-03
ependymoma 1.600 4.5e-03
glioblastoma 1.200 8.8e-03
group 4 medulloblastoma 1.400 3.4e-03
medulloblastoma, large-cell 1.700 2.4e-05
oligodendroglioma 1.600 2.4e-03
osteosarcoma 2.191 1.8e-06
ovarian cancer -1.400 2.2e-07

Gene RIF (1)

AA Sequence

MAALSPTFATSTQDSTCLQDSEFPVSSKDHSCPQNLDLFVCSGLEPHTPSVGSQESVTFQDVAVDFTEKE      1 - 70
WPLLDSSQRKLYKDVMLENYSNLTSLGYQVGKPSLISHLEQEEEPRTEERGAHQGACADWETPSKTKWSL     71 - 140
LMEDIFGKETPSGVTMERAGLGEKSTEYAHLFEVFGMDPHLTQPMGRHAGKRPYHRRDYGVAFKGRPHLT    141 - 210
QHMSMYDGRKMHECHQCQKAFTTSASLTRHRRIHTGEKPYECSDCGKAFNDPSALRSHARTHLKEKPFDC    211 - 280
SQCGNAFRTLSALKIHMRVHTGERPYKCDQCGKAYGRSCHLIAHKRTHTGERPYECHDCGKAFQHPSHLK    281 - 350
EHVRNHTGEKPYACTQCGKAFRWKSNFNLHKKNHMVEKTYECKECGKSFGDLVSRRKHMRIHIVKKPVEC    351 - 420
RQCGKTFRNQSILKTHMNSHTGEKPYGCDLCGKAFSASSNLTAHRKIHTQERRYECAACGKVFGDYLSRR    421 - 490
RHMSVHLVKKRVECRQCGKAFRNQSTLKTHMRSHTGEKPYECDHCGKAFSIGSNLNVHRRIHTGEKPYEC    491 - 560
LVCGKAFSDHSSLRSHVKTHRGEKLFVSSVWKRLQ                                       561 - 595
//

Text Mined References (9)

PMID Year Title