Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 2.17768469122398E-7
osteosarcoma 7933 1.80150676919781E-6
medulloblastoma, large-cell 6234 2.40342770728395E-5
atypical teratoid / rhabdoid tumor 4369 0.00101604491090327
oligodendroglioma 2849 0.00244062609480466
group 4 medulloblastoma 1875 0.00340010709309436
ependymoma 2514 0.00445094709220628
astrocytic glioma 2241 0.00827651231363882
glioblastoma 5572 0.00882408493978728
acute myeloid leukemia 785 0.0354067045534178

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.100 0.008
ependymoma 1.600 0.004
oligodendroglioma 1.600 0.002
osteosarcoma 2.191 0.000
atypical teratoid / rhabdoid tumor 1.300 0.001
glioblastoma 1.200 0.009
group 4 medulloblastoma 1.400 0.003
medulloblastoma, large-cell 1.700 0.000
acute myeloid leukemia 1.500 0.035
ovarian cancer -1.400 0.000

Synonym

Accession Q96PQ6 Q6DCA9 Q96PM0 Q96PM1 Q96PT2 Q9HCI4
Symbols

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
11688974 molecular cloning and characterization of isoforms

AA Sequence

MAALSPTFATSTQDSTCLQDSEFPVSSKDHSCPQNLDLFVCSGLEPHTPSVGSQESVTFQDVAVDFTEKE      1 - 70
WPLLDSSQRKLYKDVMLENYSNLTSLGYQVGKPSLISHLEQEEEPRTEERGAHQGACADWETPSKTKWSL     71 - 140
LMEDIFGKETPSGVTMERAGLGEKSTEYAHLFEVFGMDPHLTQPMGRHAGKRPYHRRDYGVAFKGRPHLT    141 - 210
QHMSMYDGRKMHECHQCQKAFTTSASLTRHRRIHTGEKPYECSDCGKAFNDPSALRSHARTHLKEKPFDC    211 - 280
SQCGNAFRTLSALKIHMRVHTGERPYKCDQCGKAYGRSCHLIAHKRTHTGERPYECHDCGKAFQHPSHLK    281 - 350
EHVRNHTGEKPYACTQCGKAFRWKSNFNLHKKNHMVEKTYECKECGKSFGDLVSRRKHMRIHIVKKPVEC    351 - 420
RQCGKTFRNQSILKTHMNSHTGEKPYGCDLCGKAFSASSNLTAHRKIHTQERRYECAACGKVFGDYLSRR    421 - 490
RHMSVHLVKKRVECRQCGKAFRNQSTLKTHMRSHTGEKPYECDHCGKAFSIGSNLNVHRRIHTGEKPYEC    491 - 560
LVCGKAFSDHSSLRSHVKTHRGEKLFVSSVWKRLQ                                       561 - 595
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21516116 2011 Next-generation sequencing to generate interactome datasets.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11688974 2001 Molecular cloning and characterization of a KRAB-containing zinc finger protein, ZNF317, and its isoforms.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.