Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MAASTASQRPLKGILKDNTSTTSSMVASAEHPRGSVHEQLSKKSQKWDEMNILATYRPADKDYGLMKIDE      1 - 70
PSTPYHSTMGDDEDACSDTETTEAMATDSLAKNLAAAEGLEPKYQVQEQESSGEEDSDLSPEEREKKRQF     71 - 140
EMRRTLHYNEGLNIKLARQLISKDLHDDDKVEEMLETAHGESMNTEESNQGSTASDQQQNKSRSS         141 - 205
//

Publication (4)

PMID Year Title
11696978 2001 Cloning of a cDNA encoding an isoform of human protein phosphatase inhibitor 2 from vascularized breast tumor.
11181995 2001 The sequence of the human genome.
8568858 1996 Evolutionary dynamics of non-coding sequences within the class II region of the human MHC.
7949733 1994 Cloning and characterization of human phosphatase inhibitor-2 (IPP-2) sequences.