Property Summary

NCBI Gene PubMed Count 14
PubMed Score 229.95
PubTator Score 2.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 3.2e-14
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Melanoma 711 0.0 0.6
Skin cancer 469 0.0 0.6
Disease Target Count Z-score Confidence
Mucocele of salivary gland 5 6.224 3.1

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.000 3.2e-14

Gene RIF (5)

AA Sequence

MLLLLLLLPPLLCGRVGAKEQKDYLLTMQKSVTVQEGLCVSVLCSFSYPQNGWTASDPVHGYWFRAGDHV      1 - 70
SRNIPVATNNPARAVQEETRDRFHLLGDPQNKDCTLSIRDTRESDAGTYVFCVERGNMKWNYKYDQLSVN     71 - 140
VTASQDLLSRYRLEVPESVTVQEGLCVSVPCSVLYPHYNWTASSPVYGSWFKEGADIPWDIPVATNTPSG    141 - 210
KVQEDTHGRFLLLGDPQTNNCSLSIRDARKGDSGKYYFQVERGSRKWNYIYDKLSVHVTALTHMPTFSIP    211 - 280
GTLESGHPRNLTCSVPWACEQGTPPTITWMGASVSSLDPTITRSSMLSLIPQPQDHGTSLTCQVTLPGAG    281 - 350
VTMTRAVRLNISYPPQNLTMTVFQGDGTASTTLRNGSALSVLEGQSLHLVCAVDSNPPARLSWTWGSLTL    351 - 420
SPSQSSNLGVLELPRVHVKDEGEFTCRAQNPLGSQHISLSLSLQNEYTGKMRPISGVTLGAFGGAGATAL    421 - 490
VFLYFCIIFVVVRSCRKKSARPAVGVGDTGMEDANAVRGSASQGPLIESPADDSPPHHAPPALATPSPEE    491 - 560
GEIQYASLSFHKARPQYPQEQEAIGYEYSEINIPK                                       561 - 595
//

Text Mined References (14)

PMID Year Title