Property Summary

NCBI Gene PubMed Count 14
Grant Count 34
R01 Count 4
Funding $18,085,590.09
PubMed Score 224.59
PubTator Score 2.17

Knowledge Summary


No data available


  Differential Expression (1)

Disease log2 FC p
psoriasis 2.000 0.000

Gene RIF (5)

23690342 cardiovascular outcomes may differ based on SIGLEC12 genotype, and antihypertensive treatment strategy.
21555517 SIGLEC12, a human-specific segregating (pseudo)gene, encodes a signaling molecule expressed in prostate carcinomas.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

GEIQYASLSFHKARPQYPQEQEAIGYEYSEINIPK                                       561 - 595

Publication (14)

PMID Year Title
23690342 2013 Pharmacogenomic association of nonsynonymous SNPs in SIGLEC12, A1BG, and the selectin region and cardiovascular outcomes.
21555517 2011 SIGLEC12, a human-specific segregating (pseudo)gene, encodes a signaling molecule expressed in prostate carcinomas.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.