Property Summary

NCBI Gene PubMed Count 6
PubMed Score 45.52
PubTator Score 46.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung carcinoma 413 9.78008941245038E-15
lung carcinoma 2844 6.93980653017929E-14
lung adenocarcinoma 2714 1.07186728473743E-9
osteosarcoma 7933 6.81816796811196E-6
ulcerative colitis 2087 6.82273664121909E-5
active Crohn's disease 918 9.6437086003649E-4
pancreatic cancer 2300 0.00338661473930894
pancreatic carcinoma 567 0.00338661473930894
interstitial cystitis 2299 0.0103317971712283
sarcoidosis 368 0.0173923494903646
urothelial carcinoma 318 0.0218886548025181
primary Sjogren syndrome 789 0.0295224534585952
head and neck cancer and chronic obstructive pulmonary disease 237 0.0317049406017046
acute myeloid leukemia 785 0.0388324689026248
inflammatory breast cancer 404 0.0455929740029285
Disease Target Count Z-score Confidence
Amenorrhea 60 4.041 2.0
Osteoporosis 259 3.226 1.6

Expression

  Differential Expression (15)

Disease log2 FC p
pancreatic cancer -1.300 0.003
urothelial carcinoma -1.600 0.022
osteosarcoma -1.981 0.000
active Crohn's disease 2.074 0.001
ulcerative colitis 1.800 0.000
sarcoidosis 1.300 0.017
interstitial cystitis 1.500 0.010
lung adenocarcinoma -1.600 0.000
primary Sjogren syndrome 1.100 0.030
pancreatic carcinoma -1.300 0.003
inflammatory breast cancer 1.100 0.046
lung carcinoma -2.700 0.000
non-small cell lung carcinoma -1.400 0.000
acute myeloid leukemia -1.300 0.039
head and neck cancer and chronic obstruc... 1.100 0.032

Synonym

Accession Q96PP9 B2R630 Q05D63 Q6NSL0 Q86T99
Symbols Mpa2

Gene

  Ortholog (1)

Species Source
Chimp OMA EggNOG

Gene RIF (5)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of guanylate binding protein 4 (GBP4) in primary human brain microvascular endothelial cells
23867815 Microarray analysis indicates HIV-1 Tat-induced upregulation of guanylate binding protein 4 (GBP4) in primary human brain microvascular endothelial cells
23333304 Microarray analysis indicates HIV-1 Tat-induced upregulation of guanylate binding protein 4 (GBP4) in primary human brain microvascular endothelial cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGERTLHAAVPTPGYPESESIMMAPICLVENQEEQLTVNSKALEILDKISQPVVVVAIVGLYRTGKSYLM      1 - 70
NRLAGKRNGFPLGSTVQSETKGIWMWCVPHLSKPNHTLVLLDTEGLGDVEKSNPKNDSWIFALAVLLSSS     71 - 140
FVYNSVSTINHQALEQLHYVTELAELIRAKSCPRPDEAEDSSEFASFFPDFIWTVRDFTLELKLDGNPIT    141 - 210
EDEYLENALKLIPGKNPKIQNSNMPRECIRHFFRKRKCFVFDRPTNDKQYLNHMDEVPEENLERHFLMQS    211 - 280
DNFCSYIFTHAKTKTLREGIIVTGKRLGTLVVTYVDAINSGAVPCLENAVTALAQLENPAAVQRAADHYS    281 - 350
QQMAQQLRLPTDTLQELLDVHAACEREAIAVFMEHSFKDENHEFQKKLVDTIEKKKGDFVLQNEEASAKY    351 - 420
CQAELKRLSEHLTESILRGIFSVPGGHNLYLEEKKQVEWDYKLVPRKGVKANEVLQNFLQSQVVVEESIL    421 - 490
QSDKALTAGEKAIAAERAMKEAAEKEQELLREKQKEQQQMMEAQERSFQEYMAQMEKKLEEERENLLREH    491 - 560
ERLLKHKLKVQEEMLKEEFQKKSEQLNKEINQLKEKIESTKNEQLRLLKILDMASNIMIVTLPGASKLLG    561 - 630
VGTKYLGSRI                                                                631 - 640
//

Text Mined References (12)

PMID Year Title
21151871 2010 Intracellular trafficking of guanylate-binding proteins is regulated by heterodimerization in a hierarchical manner.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17266443 2007 Unique features of different members of the human guanylate-binding protein family.
16689661 2006 In silico genomic analysis of the human and murine guanylate-binding protein (GBP) gene clusters.
16108726 2005 The guanylate-binding proteins (GBPs): proinflammatory cytokine-induced members of the dynamin superfamily with unique GTPase activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12693554 2003 Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones.
More...