Property Summary

NCBI Gene PubMed Count 6
PubMed Score 45.82
PubTator Score 46.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 2.074 9.6e-04
active ulcerative colitis 1.272 2.3e-02
acute myeloid leukemia -1.300 3.9e-02
Astrocytoma, Pilocytic 1.100 2.3e-04
head and neck cancer and chronic obstruc... 1.100 3.2e-02
inflammatory breast cancer 1.100 4.6e-02
interstitial cystitis 1.500 1.0e-02
lung adenocarcinoma -1.600 1.1e-09
lung carcinoma -2.700 6.9e-14
non-small cell lung carcinoma -1.400 9.8e-15
osteosarcoma -1.981 6.8e-06
pancreatic cancer -1.300 3.4e-03
pancreatic carcinoma -1.300 3.4e-03
primary Sjogren syndrome 1.100 3.0e-02
sarcoidosis 1.100 1.3e-02
urothelial carcinoma -1.600 2.2e-02

Gene RIF (5)

AA Sequence

MGERTLHAAVPTPGYPESESIMMAPICLVENQEEQLTVNSKALEILDKISQPVVVVAIVGLYRTGKSYLM      1 - 70
NRLAGKRNGFPLGSTVQSETKGIWMWCVPHLSKPNHTLVLLDTEGLGDVEKSNPKNDSWIFALAVLLSSS     71 - 140
FVYNSVSTINHQALEQLHYVTELAELIRAKSCPRPDEAEDSSEFASFFPDFIWTVRDFTLELKLDGNPIT    141 - 210
EDEYLENALKLIPGKNPKIQNSNMPRECIRHFFRKRKCFVFDRPTNDKQYLNHMDEVPEENLERHFLMQS    211 - 280
DNFCSYIFTHAKTKTLREGIIVTGKRLGTLVVTYVDAINSGAVPCLENAVTALAQLENPAAVQRAADHYS    281 - 350
QQMAQQLRLPTDTLQELLDVHAACEREAIAVFMEHSFKDENHEFQKKLVDTIEKKKGDFVLQNEEASAKY    351 - 420
CQAELKRLSEHLTESILRGIFSVPGGHNLYLEEKKQVEWDYKLVPRKGVKANEVLQNFLQSQVVVEESIL    421 - 490
QSDKALTAGEKAIAAERAMKEAAEKEQELLREKQKEQQQMMEAQERSFQEYMAQMEKKLEEERENLLREH    491 - 560
ERLLKHKLKVQEEMLKEEFQKKSEQLNKEINQLKEKIESTKNEQLRLLKILDMASNIMIVTLPGASKLLG    561 - 630
VGTKYLGSRI                                                                631 - 640
//

Text Mined References (12)

PMID Year Title