Property Summary

NCBI Gene PubMed Count 6
Grant Count 4
R01 Count 4
Funding $197,815.74
PubMed Score 45.52
PubTator Score 46.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
pancreatic cancer -1.300 0.003
urothelial carcinoma -1.600 0.022
osteosarcoma -1.981 0.000
active Crohn's disease 2.074 0.001
ulcerative colitis 1.800 0.000
sarcoidosis 1.300 0.017
interstitial cystitis 1.500 0.010
lung adenocarcinoma -1.600 0.000
primary Sjogren syndrome 1.100 0.030
pancreatic carcinoma -1.300 0.003
inflammatory breast cancer 1.100 0.046
lung carcinoma -2.700 0.000
non-small cell lung carcinoma -1.400 0.000
acute myeloid leukemia -1.300 0.039
head and neck cancer and chronic obstruc... 1.100 0.032

Gene RIF (5)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of guanylate binding protein 4 (GBP4) in primary human brain microvascular endothelial cells
23867815 Microarray analysis indicates HIV-1 Tat-induced upregulation of guanylate binding protein 4 (GBP4) in primary human brain microvascular endothelial cells
23333304 Microarray analysis indicates HIV-1 Tat-induced upregulation of guanylate binding protein 4 (GBP4) in primary human brain microvascular endothelial cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGERTLHAAVPTPGYPESESIMMAPICLVENQEEQLTVNSKALEILDKISQPVVVVAIVGLYRTGKSYLM      1 - 70
NRLAGKRNGFPLGSTVQSETKGIWMWCVPHLSKPNHTLVLLDTEGLGDVEKSNPKNDSWIFALAVLLSSS     71 - 140
FVYNSVSTINHQALEQLHYVTELAELIRAKSCPRPDEAEDSSEFASFFPDFIWTVRDFTLELKLDGNPIT    141 - 210
EDEYLENALKLIPGKNPKIQNSNMPRECIRHFFRKRKCFVFDRPTNDKQYLNHMDEVPEENLERHFLMQS    211 - 280
DNFCSYIFTHAKTKTLREGIIVTGKRLGTLVVTYVDAINSGAVPCLENAVTALAQLENPAAVQRAADHYS    281 - 350
QQMAQQLRLPTDTLQELLDVHAACEREAIAVFMEHSFKDENHEFQKKLVDTIEKKKGDFVLQNEEASAKY    351 - 420
CQAELKRLSEHLTESILRGIFSVPGGHNLYLEEKKQVEWDYKLVPRKGVKANEVLQNFLQSQVVVEESIL    421 - 490
QSDKALTAGEKAIAAERAMKEAAEKEQELLREKQKEQQQMMEAQERSFQEYMAQMEKKLEEERENLLREH    491 - 560
ERLLKHKLKVQEEMLKEEFQKKSEQLNKEINQLKEKIESTKNEQLRLLKILDMASNIMIVTLPGASKLLG    561 - 630
VGTKYLGSRI                                                                631 - 640
//

Text Mined References (12)

PMID Year Title
21151871 2010 Intracellular trafficking of guanylate-binding proteins is regulated by heterodimerization in a hierarchical manner.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17266443 2007 Unique features of different members of the human guanylate-binding protein family.
16689661 2006 In silico genomic analysis of the human and murine guanylate-binding protein (GBP) gene clusters.
16108726 2005 The guanylate-binding proteins (GBPs): proinflammatory cytokine-induced members of the dynamin superfamily with unique GTPase activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12693554 2003 Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones.
More...