Property Summary

NCBI Gene PubMed Count 16
PubMed Score 16.02
PubTator Score 10.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
head and neck cancer and chronic obstruc... 1.500 5.1e-03
inflammatory breast cancer 2.000 1.9e-02
interstitial cystitis 2.500 1.3e-03
invasive ductal carcinoma 1.800 1.0e-03
lung carcinoma -2.500 2.5e-12
nasopharyngeal carcinoma 1.400 1.5e-03
osteosarcoma -1.724 6.6e-03
ovarian cancer 1.100 6.4e-03
primary Sjogren syndrome 1.400 1.6e-03
psoriasis 1.400 4.9e-11
sarcoidosis 2.000 3.2e-02
tuberculosis 1.400 1.6e-02
ulcerative colitis 1.600 2.5e-03
uncontrolled asthma -1.300 3.2e-02

Gene RIF (14)

AA Sequence

MALEIHMSDPMCLIENFNEQLKVNQEALEILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKNKGFSVAST      1 - 70
VQSHTKGIWIWCVPHPNWPNHTLVLLDTEGLGDVEKADNKNDIQIFALALLLSSTFVYNTVNKIDQGAID     71 - 140
LLHNVTELTDLLKARNSPDLDRVEDPADSASFFPDLVWTLRDFCLGLEIDGQLVTPDEYLENSLRPKQGS    141 - 210
DQRVQNFNLPRLCIQKFFPKKKCFIFDLPAHQKKLAQLETLPDDELEPEFVQQVTEFCSYIFSHSMTKTL    211 - 280
PGGIMVNGSRLKNLVLTYVNAISSGDLPCIENAVLALAQRENSAAVQKAIAHYDQQMGQKVQLPMETLQE    281 - 350
LLDLHRTSEREAIEVFMKNSFKDVDQSFQKELETLLDAKQNDICKRNLEASSDYCSALLKDIFGPLEEAV    351 - 420
KQGIYSKPGGHNLFIQKTEELKAKYYREPRKGIQAEEVLQKYLKSKESVSHAILQTDQALTETEKKKKEA    421 - 490
QVKAEAEKAEAQRLAAIQRQNEQMMQERERLHQEQVRQMEIAKQNWLAEQQKMQEQQMQEQAAQLSTTFQ    491 - 560
AQNRSLLSELQHAQRTVNNDDPCVLL                                                561 - 586
//

Text Mined References (17)

PMID Year Title