Property Summary

NCBI Gene PubMed Count 14
Grant Count 8
R01 Count 6
Funding $477,920.4
PubMed Score 12.60
PubTator Score 10.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
uncontrolled asthma -1.300 0.032
osteosarcoma -1.724 0.007
tuberculosis 1.400 0.016
sarcoidosis 2.400 0.027
interstitial cystitis 3.200 0.001
primary Sjogren syndrome 1.400 0.002
nasopharyngeal carcinoma 1.400 0.001
psoriasis 2.500 0.000
inflammatory breast cancer 2.000 0.019
lung carcinoma -2.500 0.000
invasive ductal carcinoma 1.800 0.001
ulcerative colitis 1.700 0.009
ovarian cancer 1.100 0.006
head and neck cancer and chronic obstruc... 1.500 0.005

Gene RIF (13)

PMID Text
26025597 GZMA, GBP5 and CD64 genes show promise as a rapid diagnostic markers separating tuberculosis from other pulmonary diseases.
25980612 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of GBP5 against production of infectious wild-type HIV-1
25980612 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of GBP5 against production of infectious wild-type HIV-1
25980612 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of GBP5 against production of infectious wild-type HIV-1
23898208 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of GBP5 against production of infectious wild-type HIV-1
23333304 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of GBP5 against production of infectious wild-type HIV-1
22461501 guanylate binding protein 5 (GBP5) stimulates inflammasome assembly; GBP5 promoted selective NLRP3 inflammasome responses to pathogenic bacteria and soluble but not crystalline inflammasome priming agents; GBP5 serves as a unique rheostat for NLRP3 inflammasome activation
21151871 The in vivo localization of GBP-5 at the Golgi apparatus is regulated by isoprenylation and dimerization.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20180847 analysis of guanylate binding protein 5 and a tumor-specific truncated splice variant
More...

AA Sequence

MALEIHMSDPMCLIENFNEQLKVNQEALEILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKNKGFSVAST      1 - 70
VQSHTKGIWIWCVPHPNWPNHTLVLLDTEGLGDVEKADNKNDIQIFALALLLSSTFVYNTVNKIDQGAID     71 - 140
LLHNVTELTDLLKARNSPDLDRVEDPADSASFFPDLVWTLRDFCLGLEIDGQLVTPDEYLENSLRPKQGS    141 - 210
DQRVQNFNLPRLCIQKFFPKKKCFIFDLPAHQKKLAQLETLPDDELEPEFVQQVTEFCSYIFSHSMTKTL    211 - 280
PGGIMVNGSRLKNLVLTYVNAISSGDLPCIENAVLALAQRENSAAVQKAIAHYDQQMGQKVQLPMETLQE    281 - 350
LLDLHRTSEREAIEVFMKNSFKDVDQSFQKELETLLDAKQNDICKRNLEASSDYCSALLKDIFGPLEEAV    351 - 420
KQGIYSKPGGHNLFIQKTEELKAKYYREPRKGIQAEEVLQKYLKSKESVSHAILQTDQALTETEKKKKEA    421 - 490
QVKAEAEKAEAQRLAAIQRQNEQMMQERERLHQEQVRQMEIAKQNWLAEQQKMQEQQMQEQAAQLSTTFQ    491 - 560
AQNRSLLSELQHAQRTVNNDDPCVLL                                                561 - 586
//

Publication (15)

PMID Year Title
26025597 2015 A real-time PCR signature to discriminate between tuberculosis and other pulmonary diseases.
22461501 2012 GBP5 promotes NLRP3 inflammasome assembly and immunity in mammals.
21151871 2010 Intracellular trafficking of guanylate-binding proteins is regulated by heterodimerization in a hierarchical manner.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20180847 2010 Biochemical properties of the human guanylate binding protein 5 and a tumor-specific truncated splice variant.
19946888 2010 Defining the membrane proteome of NK cells.
18260761 2008 Oligonucleotide microarray analysis of gene expression profiles followed by real-time reverse-transcriptase polymerase chain reaction assay in chronic active Epstein-Barr virus infection.
17266443 2007 Unique features of different members of the human guanylate-binding protein family.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...