Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.95
PubTator Score 1.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Synonym

Accession Q96PP4 B3KSC9
Symbols

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
26111495 the data from the current study strongly suggest the association between TSGA13 and tumor malignancy.

AA Sequence

MSQKRQTKFQNGKSKTSENSSAKREKGMVVNSKEISDAVGQSKFVLENLRHYTVHPNLAQYYKPLKATAL      1 - 70
QKFLAQNRKNTSFMLKVTQYDQDKTLLIMTNNPPPCSITQQDKESASKYFSKELLLKVMESHHQHKPTEN     71 - 140
LWLPRMPQKKKLRSKLKPIFPLILSDDPTSKREQWFRFSTDNDFKSEGKYSKVYALRTQKKMYPQLTFAP    141 - 210
VHERDMRKDASKKSASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVIG         211 - 275
//

Text Mined References (9)

PMID Year Title
26111495 2015 Histochemical analysis of testis specific gene 13 in human normal and malignant tissues.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14962666 2004 Imprinting analysis of 10 genes and/or transcripts in a 1.5-Mb MEST-flanking region at human chromosome 7q32.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.