Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.95
PubTator Score 1.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Synonym

Accession Q96PP4 B3KSC9
Symbols

Gene

 Compartment GO Term (0)

Protein-protein Interaction (2)

Gene RIF (1)

PMID Text
26111495 the data from the current study strongly suggest the association between TSGA13 and tumor malignancy.

AA Sequence

MSQKRQTKFQNGKSKTSENSSAKREKGMVVNSKEISDAVGQSKFVLENLRHYTVHPNLAQYYKPLKATAL      1 - 70
QKFLAQNRKNTSFMLKVTQYDQDKTLLIMTNNPPPCSITQQDKESASKYFSKELLLKVMESHHQHKPTEN     71 - 140
LWLPRMPQKKKLRSKLKPIFPLILSDDPTSKREQWFRFSTDNDFKSEGKYSKVYALRTQKKMYPQLTFAP    141 - 210
VHERDMRKDASKKSASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVIG         211 - 275
//

Publication (9)

PMID Year Title
26111495 2015 Histochemical analysis of testis specific gene 13 in human normal and malignant tissues.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14962666 2004 Imprinting analysis of 10 genes and/or transcripts in a 1.5-Mb MEST-flanking region at human chromosome 7q32.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.