Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.86
PubTator Score 2.90

Knowledge Summary

Patent (1,299)

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 2.085 0.000
ovarian cancer 1.200 0.000

Synonym

Accession Q96PN8 Q5TEE5 TSK-3
Symbols TSK3
SPOGA3
STK22C
STK22D

Gene

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

Gene RIF (2)

PMID Text
16336268 PDK1-induced phosphorylation increased in vitro TSSK3 kinase activity, suggesting that TSSK3 can be regulated in the same way as AGC kinase family members. The peptide sequence RRSSSY containing Ser5 is identified as a target for TSSK3 phosphorylation
11597141 human homolog of mouse stk22d; It was cloned and found it to be expressed exclusively in the testis.

AA Sequence

MEDFLLSNGYQLGKTIGEGTYSKVKEAFSKKHQRKVAIKVIDKMGGPEEFIQRFLPRELQIVRTLDHKNI      1 - 70
IQVYEMLESADGKICLVMELAEGGDVFDCVLNGGPLPESRAKALFRQMVEAIRYCHGCGVAHRDLKCENA     71 - 140
LLQGFNLKLTDFGFAKVLPKSHRELSQTFCGSTAYAAPEVLQGIPHDSKKGDVWSMGVVLYVMLCASLPF    141 - 210
DDTDIPKMLWQQQKGVSFPTHLSISADCQDLLKRLLEPDMILRPSIEEVSWHPWLAST                211 - 268
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16336268 2005 Characterization of testis-specific serine-threonine kinase 3 and its activation by phosphoinositide-dependent kinase-1-dependent signalling.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11597141 2001 Cloning and chromosomal localization of a gene encoding a novel serine/threonine kinase belonging to the subfamily of testis-specific kinases.