Tbio | Testis-specific serine/threonine-protein kinase 3 |
May be involved in a signaling pathway during male germ cell development or mature sperm function.
This gene encodes a kinase expressed exclusively in the testis that is thought to play a role in either germ cell differentiation or mature sperm function. [provided by RefSeq, Jul 2008]
This gene encodes a kinase expressed exclusively in the testis that is thought to play a role in either germ cell differentiation or mature sperm function. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count | P-value |
---|---|---|
ovarian cancer | 8492 | 1.51782271732894E-8 |
osteosarcoma | 7933 | 2.86939796844157E-7 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Oligospermia | 30 | 4.152 | 2.1 |
Azoospermia | 89 | 3.015 | 1.5 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Chicken | OMA Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
16336268 | PDK1-induced phosphorylation increased in vitro TSSK3 kinase activity, suggesting that TSSK3 can be regulated in the same way as AGC kinase family members. The peptide sequence RRSSSY containing Ser5 is identified as a target for TSSK3 phosphorylation |
11597141 | human homolog of mouse stk22d; It was cloned and found it to be expressed exclusively in the testis. |
MEDFLLSNGYQLGKTIGEGTYSKVKEAFSKKHQRKVAIKVIDKMGGPEEFIQRFLPRELQIVRTLDHKNI 1 - 70 IQVYEMLESADGKICLVMELAEGGDVFDCVLNGGPLPESRAKALFRQMVEAIRYCHGCGVAHRDLKCENA 71 - 140 LLQGFNLKLTDFGFAKVLPKSHRELSQTFCGSTAYAAPEVLQGIPHDSKKGDVWSMGVVLYVMLCASLPF 141 - 210 DDTDIPKMLWQQQKGVSFPTHLSISADCQDLLKRLLEPDMILRPSIEEVSWHPWLAST 211 - 268 //
PMID | Year | Title |
---|---|---|
25416956 | 2014 | A proteome-scale map of the human interactome network. |
17344846 | 2007 | Patterns of somatic mutation in human cancer genomes. |
16710414 | 2006 | The DNA sequence and biological annotation of human chromosome 1. |
16336268 | 2005 | Characterization of testis-specific serine-threonine kinase 3 and its activation by phosphoinositide-dependent kinase-1-dependent signalling. |
15761153 | 2005 | High-throughput mapping of a dynamic signaling network in mammalian cells. |
15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. |
11597141 | 2001 | Cloning and chromosomal localization of a gene encoding a novel serine/threonine kinase belonging to the subfamily of testis-specific kinases. |