Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.14
PubTator Score 168.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma -1.587 0.045
glioblastoma -1.200 0.001
medulloblastoma, large-cell -1.600 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.007
intraductal papillary-mucinous neoplasm ... 1.700 0.020
sarcoidosis 1.400 0.007
interstitial cystitis -1.200 0.000
primary Sjogren syndrome 1.400 0.002
ulcerative colitis 1.300 0.000
ovarian cancer -1.400 0.001
pituitary cancer 1.700 0.000
chronic rhinosinusitis -1.035 0.010
head and neck cancer -1.200 0.009

Synonym

Accession Q96PN7 Q05GC6 Q7Z6T2 Q7Z6T3 Q9NQ72 Q9NQ73 Q9NUN9
Symbols RAPA
BCAR2
TREP132
TReP-132
HSA277276
dJ139D8.5

Gene

Gene RIF (8)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17015480 identify TReP-132 as a coactivator of progesterone receptor mediating the growth-inhibitory and differentiation effects of progesterone on breast cancer cells
15899840 TReP-132 is a basal cell cycle regulatory protein interacting with Sp1 to activate the p21 and p27 gene promoters.
15072559 TReP-132 is a trans-acting factor of genes involved in adrenal glucocorticoid, C(19) steroid and estrogen production.
12530663 TReP-132 interacts with steroidogenic factor-1 (SF-1) through specific domains; and along with the interaction with CBP/p300 these factors are postulated to form a complex to regulate expression of the P450scc gene.
12101186 TReP-132 plays a role in regulating p450scc expression with steroidogenic factor-1 and CBP/p300

AA Sequence

MGDQQLYKTNHVAHGSENLFYQQPPLGVHSGLNHNYGNAVTGGGMDAPQASPISPHFPQDTRDGLGLPVG      1 - 70
SKNLGQMDTSRQGGWGSHAGPGNHVQLRGNLANSNMMWGAPAQAEPTDGYQYTYSQASEIRTQKLTSGVL     71 - 140
HKLDSFTQVFANQNLRIQVNNMAQVLHTQSAVMDGAPDSALRQLLSQKPMEPPAPAIPSRYQQVPQQPHP    141 - 210
GFTGGLSKPALQVGQHPTQGHLYYDYQQPLAQVPVQGGQPLQAPQMLSQHMQQMQQHQYYPPQQQQQAGQ    211 - 280
QRISMQEIQTQPQQIRPSQPQPPPQQQQPQQLQLQQRQGSMQIPQYYQPQPMMQHLQEQQQQQMHLQPPS    281 - 350
YHRDPHQYTPEQAHTVQLIPLGSMSQYYYQEPQQPYSHPLYQQSHLSQHQQREDSQLKTYSSDRQAQAML    351 - 420
SSHGDLGPPDTGMGDPASSDLTRVSSTLPHRPLLSPSGIHLNNMGPQHQQLSPSAMWPQMHLPDGRAQPG    421 - 490
SPESSGQPKGAFGEQFDAKNKLTCSICLKEFKNLPALNGHMRSHGGMRASPNLKQEEGEKVLPPQPQPPL    491 - 560
PPPPPPPPPPQLPPEAESLTPMVMPVSVPVKLLPPKPSSQGFTNSTVAAPSARDKPASSMSDDEMPVLEI    561 - 630
PRKHQPSVPKAEEPLKTVQEKKKFRHRPEPLFIPPPPSYNPNPAASYSGATLYQSQLRSPRVLGDHLLLD    631 - 700
PTHELPPYTPPPMLSPVRQGSGLFSNVLISGHGPGAHPQLPLTPLTPTPRVLLCRSNSIDGSNVTVTPGP    701 - 770
GEQTVDVEPRINIGLRFQAEIPELQDISALAQDTHKATLVWKPWPELENHDLQQRVENLLNLCCSSALPG    771 - 840
GGTNSEFALHSLFEAKGDVMVALEMLLLRKPVRLKCHPLANYHYAGSDKWTSLERKLFNKALATYSKDFI    841 - 910
FVQKMVKSKTVAQCVEYYYTWKKIMRLGRKHRTRLAEIIDDCVTSEEEEELEEEEEEDPEEDRKSTKEEE    911 - 980
SEVPKSPEPPPVPVLAPTEGPPLQALGQPSGSFICEMPNCGAVFSSRQALNGHARIHGGTNQVTKARGAI    981 - 1050
PSGKQKPGGTQSGYCSVKSSPSHSTTSGETDPTTIFPCKECGKVFFKIKSRNAHMKTHRQQEEQQRQKAQ   1051 - 1120
KAAFAAEMAATIERTTGPVGAPGLLPLDQLSLIKPIKDVDILDDDVVQQLGGVMEEAEVVDTDLLLDDQD   1121 - 1190
SVLLQGDAEL                                                               1191 - 1200
//

Publication (21)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21573134 2011 Nuclear cGMP-dependent kinase regulates gene expression via activity-dependent recruitment of a conserved histone deacetylase complex.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18351453 2009 Functional identification of genes causing estrogen independence of human breast cancer cells.
More...