Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.18
PubTator Score 168.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
chronic rhinosinusitis -1.035 1.0e-02
glioblastoma -1.200 8.8e-04
head and neck cancer -1.200 8.6e-03
interstitial cystitis -1.200 1.4e-04
intraductal papillary-mucinous adenoma (... 1.100 6.7e-03
intraductal papillary-mucinous neoplasm ... 1.700 2.0e-02
medulloblastoma, large-cell -1.600 2.0e-04
osteosarcoma -1.587 4.5e-02
ovarian cancer -1.200 5.0e-04
pituitary cancer 1.700 3.3e-06
primary Sjogren syndrome 1.400 1.6e-03
sarcoidosis 1.400 7.1e-03
ulcerative colitis 1.300 1.0e-07

Gene RIF (8)

AA Sequence

MGDQQLYKTNHVAHGSENLFYQQPPLGVHSGLNHNYGNAVTGGGMDAPQASPISPHFPQDTRDGLGLPVG      1 - 70
SKNLGQMDTSRQGGWGSHAGPGNHVQLRGNLANSNMMWGAPAQAEPTDGYQYTYSQASEIRTQKLTSGVL     71 - 140
HKLDSFTQVFANQNLRIQVNNMAQVLHTQSAVMDGAPDSALRQLLSQKPMEPPAPAIPSRYQQVPQQPHP    141 - 210
GFTGGLSKPALQVGQHPTQGHLYYDYQQPLAQVPVQGGQPLQAPQMLSQHMQQMQQHQYYPPQQQQQAGQ    211 - 280
QRISMQEIQTQPQQIRPSQPQPPPQQQQPQQLQLQQRQGSMQIPQYYQPQPMMQHLQEQQQQQMHLQPPS    281 - 350
YHRDPHQYTPEQAHTVQLIPLGSMSQYYYQEPQQPYSHPLYQQSHLSQHQQREDSQLKTYSSDRQAQAML    351 - 420
SSHGDLGPPDTGMGDPASSDLTRVSSTLPHRPLLSPSGIHLNNMGPQHQQLSPSAMWPQMHLPDGRAQPG    421 - 490
SPESSGQPKGAFGEQFDAKNKLTCSICLKEFKNLPALNGHMRSHGGMRASPNLKQEEGEKVLPPQPQPPL    491 - 560
PPPPPPPPPPQLPPEAESLTPMVMPVSVPVKLLPPKPSSQGFTNSTVAAPSARDKPASSMSDDEMPVLEI    561 - 630
PRKHQPSVPKAEEPLKTVQEKKKFRHRPEPLFIPPPPSYNPNPAASYSGATLYQSQLRSPRVLGDHLLLD    631 - 700
PTHELPPYTPPPMLSPVRQGSGLFSNVLISGHGPGAHPQLPLTPLTPTPRVLLCRSNSIDGSNVTVTPGP    701 - 770
GEQTVDVEPRINIGLRFQAEIPELQDISALAQDTHKATLVWKPWPELENHDLQQRVENLLNLCCSSALPG    771 - 840
GGTNSEFALHSLFEAKGDVMVALEMLLLRKPVRLKCHPLANYHYAGSDKWTSLERKLFNKALATYSKDFI    841 - 910
FVQKMVKSKTVAQCVEYYYTWKKIMRLGRKHRTRLAEIIDDCVTSEEEEELEEEEEEDPEEDRKSTKEEE    911 - 980
SEVPKSPEPPPVPVLAPTEGPPLQALGQPSGSFICEMPNCGAVFSSRQALNGHARIHGGTNQVTKARGAI    981 - 1050
PSGKQKPGGTQSGYCSVKSSPSHSTTSGETDPTTIFPCKECGKVFFKIKSRNAHMKTHRQQEEQQRQKAQ   1051 - 1120
KAAFAAEMAATIERTTGPVGAPGLLPLDQLSLIKPIKDVDILDDDVVQQLGGVMEEAEVVDTDLLLDDQD   1121 - 1190
SVLLQGDAEL                                                               1191 - 1200
//

Text Mined References (21)

PMID Year Title