Property Summary

NCBI Gene PubMed Count 36
Grant Count 196
R01 Count 105
Funding $36,380,671.63
PubMed Score 1279.34
PubTator Score 100.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 2.500 0.000

Synonym

Accession Q96PN6 B4DZF0 F5GWS5 O95558 Q5R329 Q5R330 Q8WXV4 Q9NNX0
Symbols SAC
HCA2
SACI
Sacy
hsAC
HEL-S-7a

Gene

PANTHER Protein Class (3)

PDB

4CLF   4CLK   4CLL   4CLP   4CLS   4CLT   4CLU   4CLW   4CLY   4CLZ   4CM0   4CM2   4OYA   4OYB   4OYI   4OYM   4OYO   4OYP   4OYW   4OYX   4OYZ   4OZ2   4OZ3   4UST   4USU   4USV   4USW   5D0R   5IV3   5IV4  

Gene RIF (19)

PMID Text
26961873 results thus provide 1) novel insights into the communication between allosteric regulatory and active sites, 2) a novel mechanism for sAC inhibition, and 3) pharmacological compounds targeting this allosteric site and utilizing this mode of inhibition.
26857816 The data support an important role for prostaglandin activation of sAC and PKA in H2O2-induced barrier disruption.
25409931 shows that in fibroblast cultures inhibition by KH7 of production in the mitochondrial matrix by soluble adenylyl cyclase
25040695 Crystal structures of human ADCY10 catalytic domains in complex with nucleotides.
24792377 Soluble adenylyl cyclase plays a role in the regulation of basal cCMP and cUMP.
24698940 Evaluation of soluble adenylyl cyclase expression using R21 antibody is a useful diagnostic adjunct in the evaluation of margins of LM during slow Mohs surgery.
24420537 sAC is a regulator of gene expression involved in aldosterone signaling and an important regulator of endothelial stiffness.
24100033 sAC is necessary for normal glucose-stimulated insulin secretion in vitro and in vivo.
23255611 Significant overexpression of soluble type 10 adenylyl cyclase (sAC), an alternative source of cAMP, was found in human prostate carcinoma.
22775536 a haem-binding domain within the C-terminus of the human soluble adenylate cyclase
More...

AA Sequence

MNTPKEEFQDWPIVRIAAHLPDLIVYGHFSPERPFMDYFDGVLMFVDISGFTAMTEKFSSAMYMDRGAEQ      1 - 70
LVEILNYHISAIVEKVLIFGGDILKFAGDALLALWRVERKQLKNIITVVIKCSLEIHGLFETQEWEEGLD     71 - 140
IRVKIGLAAGHISMLVFGDETHSHFLVIGQAVDDVRLAQNMAQMNDVILSPNCWQLCDRSMIEIESVPDQ    141 - 210
RAVKVNFLKPPPNFNFDEFFTKCTTFMHYYPSGEHKNLLRLACTLKPDPELEMSLQKYVMESILKQIDNK    211 - 280
QLQGYLSELRPVTIVFVNLMFEDQDKAEEIGPAIQDAYMHITSVLKIFQGQINKVFMFDKGCSFLCVFGF    281 - 350
PGEKVPDELTHALECAMDIFDFCSQVHKIQTVSIGVASGIVFCGIVGHTVRHEYTVIGQKVNLAARMMMY    351 - 420
YPGIVTCDSVTYNGSNLPAYFFKELPKKVMKGVADSGPLYQYWGRTEKVMFGMACLICNRKEDYPLLGRN    421 - 490
KEINYFMYTMKKFLISNSSQVLMYEGLPGYGKSQILMKIEYLAQGKNHRIIAISLNKISFHQTFYTIQMF    491 - 560
MANVLGLDTCKHYKERQTNLRNKVMTLLDEKFYCLLNDIFHVQFPISREISRMSTLKKQKQLEILFMKIL    561 - 630
KLIVKEERIIFIIDEAQFVDSTSWRFMEKLIRTLPIFIIMSLCPFVNIPCAAARAVIKNRNTTYIVIGAV    631 - 700
QPNDISNKICLDLNVSCISKELDSYLGEGSCGIPFYCEELLKNLEHHEVLVFQQTESEEKTNRTWNNLFK    701 - 770
YSIKLTEKLNMVTLHSDKESEEVCHLTSGVRLKNLSPPTSLKEISLIQLDSMRLSHQMLVRCAAIIGLTF    771 - 840
TTELLFEILPCWNMKMMIKTLATLVESNIFYCFRNGKELQKALKQNDPSFEVHYRSLSLKPSEGMDHGEE    841 - 910
EQLRELENEVIECHRIRFCNPMMQKTAYELWLKDQRKAMHLKCARFLEEDAHRCDHCRGRDFIPYHHFTV    911 - 980
NIRLNALDMDAIKKMAMSHGFKTEEKLILSNSEIPETSAFFPENRSPEEIREKILNFFDHVLTKMKTSDE    981 - 1050
DIIPLESCQCEEILEIVILPLAHHFLALGENDKALYYFLEIASAYLIFCDNYMAYMYLNEGQKLLKTLKK   1051 - 1120
DKSWSQTFESATFYSLKGEVCFNMGQIVLAKKMLRKALKLLNRIFPYNLISLFLHIHVEKNRHFHYVNRQ   1121 - 1190
AQESPPPGKKRLAQLYRQTVCLSLLWRIYSYSYLFHCKYYAHLAVMMQMNTALETQNCFQIIKAYLDYSL   1191 - 1260
YHHLAGYKGVWFKYEVMAMEHIFNLPLKGEGIEIVAYVAETLVFNKLIMGHLDLAIELGSRALQMWALLQ   1261 - 1330
NPNRHYQSLCRLSRCLLLNSRYPQLIQVLGRLWELSVTQEHIFSKAFFYFVCLDILLYSGFVYRTFEECL   1331 - 1400
EFIHQYENNRILKFHSGLLLGLYSSVAIWYARLQEWDNFYKFSNRAKNLLPRRTMTLTYYDGISRYMEGQ   1401 - 1470
VLHLQKQIKEQSENAQASGEELLKNLENLVAQNTTGPVFCPRLYHLMAYVCILMGDGQKCGLFLNTALRL   1471 - 1540
SETQGNILEKCWLNMNKESWYSTSELKEDQWLQTILSLPSWEKIVAGRVNIQDLQKNKFLMRANTVDNHF   1541 - 1610
//

Text Mined References (40)

PMID Year Title
26961873 2016 Bithionol Potently Inhibits Human Soluble Adenylyl Cyclase through Binding to the Allosteric Activator Site.
26857816 2016 Soluble adenylyl cyclase mediates hydrogen peroxide-induced changes in epithelial barrier function.
25409931 2015 Intramitochondrial adenylyl cyclase controls the turnover of nuclear-encoded subunits and activity of mammalian complex I of the respiratory chain.
25040695 2014 Structural analysis of human soluble adenylyl cyclase and crystal structures of its nucleotide complexes-implications for cyclase catalysis and evolution.
24792377 2014 Soluble adenylyl cyclase accounts for high basal cCMP and cUMP concentrations in HEK293 and B103 cells.
24698940 2014 Soluble adenylyl cyclase antibody (R21) as a diagnostic adjunct in the evaluation of lentigo maligna margins during slow Mohs surgery.
24616449 2014 Crystal structure of human soluble adenylate cyclase reveals a distinct, highly flexible allosteric bicarbonate binding pocket.
24567411 2014 Crystal structures of human soluble adenylyl cyclase reveal mechanisms of catalysis and of its activation through bicarbonate.
24420537 2014 Soluble adenylyl cyclase in vascular endothelium: gene expression control of epithelial sodium channel-?, Na+/K+-ATPase-?/?, and mineralocorticoid receptor.
24100033 2013 CO2/HCO3(-)- and calcium-regulated soluble adenylyl cyclase as a physiological ATP sensor.
More...