Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.24
PubTator Score 3.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
group 3 medulloblastoma 4104 1.0e-02
Rheumatoid arthritis 1191 3.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma -1.500 1.0e-02
Rheumatoid arthritis -1.100 3.7e-02

Gene RIF (2)

AA Sequence

MILGSLSRAGPLPLLRQPPIMQPPLDLKQILPFPLEPAPTLGLFSNYSTMDPVQKAVLSHTFGGPLLKTK      1 - 70
RPVISCNICQIRFNSQSQAEAHYKGNRHARRVKGIEAAKTRGREPGVREPGDPAPPGSTPTNGDGVAPRP     71 - 140
VSMENGLGPAPGSPEKQPGSPSPPSIPETGQGVTKGEGGTPAPASLPGGSKEEEEKAKRLLYCALCKVAV    141 - 210
NSLSQLEAHNKGTKHKTILEARSGLGPIKAYPRLGPPTPGEPEAPAQDRTFHCEICNVKVNSEVQLKQHI    211 - 280
SSRRHRDGVAGKPNPLLSRHKKSRGAGELAGTLTFSKELPKSLAGGLLPSPLAVAAVMAAAAGSPLSLRP    281 - 350
APAAPLLQGPPITHPLLHPAPGPIRTAHGPILFSPY                                      351 - 386
//

Text Mined References (14)

PMID Year Title