Property Summary

NCBI Gene PubMed Count 48
Grant Count 170
R01 Count 22
Funding $89,193,644.96
PubMed Score 282.14
PubTator Score 133.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Rheumatoid Arthritis 1.500 0.040
Multiple myeloma 1.430 0.004
subependymal giant cell astrocytoma -1.205 0.022
spina bifida -1.290 0.036
ovarian cancer -2.900 0.000

Synonym

Accession Q96PM5 B3KRG3 C7E541 C7E542 C7E543 D3YRV2 E7EMC8 E7ETW5 J3KPI0 Q2KN33 Q59GN7 Q86X26 Q96PR5
Symbols ZCHY
ARNIP
CHIMP
PIRH2
RNF199
ZNF363
PRO1996

Gene

PANTHER Protein Class (2)

PDB

2JRJ   2K2C   2K2D  

 MGI Term (1)

Gene RIF (34)

PMID Text
26995965 Tumor suppressor p63 regulates expression of ubiquitin ligase PIRH2.
26496426 The Hoxa2-mediated decay of RCHY1 involves both the 19S and 20S proteasome complexes
25848801 Overexpression of Pirh2 decreased the replication of prototype foamy virus, whereas knockdown of Pirh2 with specific siRNA increased PFV replication.
23449389 Findings indicate that PIRH2 has central roles in the ubiquitylation of Chk2 and its turnover and in the regulation of its function.
23235527 Pirh2 has a physiologically relevant role in keratinocyte differentiation through the posttranslational modification of p63 protein.
22766706 Compared to full-length PIRH2A, PIRH2E lacks amino acids 235-261, while PIRH2F is missing C-terminal amino acids 227-261 and both isoforms harbor the RING domain.
22570270 suggested that the interaction of SCYL1BP1/Pirh2 could accelerate Pirh2 degradation through an ubiquitin-dependent pathway. SCYL1BP1 may function as an important tumor suppressor gene in HCC development
22125490 low expression of human PIRH2 in lung, ovarian, and breast cancers correlates with decreased patients' survival
21852228 Pirh2 promotes the proteasomal turnover of TAp73, and thus targeting Pirh2 to restore TAp73-mediated growth suppression in p53-deficient tumors may be developed as a novel anti-cancer strategy.
21791603 Data show that Pirh2 monoubiquitinates PolH at one of multiple lysine residues, and that monoubiquitination of PolH inhibits its ability to interact with PCNA and bypass UV-induced lesions, leading to decreased viability.
More...

AA Sequence

MAATAREDGASGQERGQRGCEHYDRGCLLKAPCCDKLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQH      1 - 70
AQQTCEECSTLFGEYYCDICHLFDKDKKQYHCENCGICRIGPKEDFFHCLKCNLCLAMNLQGRHKCIENV     71 - 140
SRQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCMHSALDMTRYWRQLDDEVAQTPMP    141 - 210
SEYQNMTVDILCNDCNGRSTVQFHILGMKCKICESYNTAQAGGRRISLDQQ                       211 - 261
//

Text Mined References (55)

PMID Year Title
26995965 2015 [TUMOR SUPPRESSOR p63 REGULATES EXPRESSION OF UBIQUITIN LIGASE Pirh2].
26496426 2015 Molecular Analysis of the HOXA2-Dependent Degradation of RCHY1.
25848801 2015 Human Pirh2 is a novel inhibitor of prototype foamy virus replication.
25416956 2014 A proteome-scale map of the human interactome network.
23603988 2013 Cdk9 phosphorylates Pirh2 protein and prevents degradation of p53 protein.
23449389 2013 The E3 ligase PIRH2 polyubiquitylates CHK2 and regulates its turnover.
23235527 2013 Pirh2 E3 ubiquitin ligase modulates keratinocyte differentiation through p63.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22766706 2012 Identification of Pirh2E and Pirh2F, two additional novel isoforms of Pirh2 ubiquitin ligase from human hepatocellular liver carcinoma cell line.
22570270 2012 SCYL1 binding protein 1 promotes the ubiquitin-dependent degradation of Pirh2 and has tumor-suppressive function in the development of hepatocellular carcinoma.
More...