Property Summary

NCBI Gene PubMed Count 50
PubMed Score 287.66
PubTator Score 133.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (5)

Disease log2 FC p
Rheumatoid arthritis 1.500 4.0e-02
Multiple myeloma 1.430 3.6e-03
ovarian cancer -2.900 2.9e-09
spina bifida -1.269 3.5e-02
subependymal giant cell astrocytoma -1.205 2.2e-02

 MGI Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (36)

AA Sequence

MAATAREDGASGQERGQRGCEHYDRGCLLKAPCCDKLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQH      1 - 70
AQQTCEECSTLFGEYYCDICHLFDKDKKQYHCENCGICRIGPKEDFFHCLKCNLCLAMNLQGRHKCIENV     71 - 140
SRQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCMHSALDMTRYWRQLDDEVAQTPMP    141 - 210
SEYQNMTVDILCNDCNGRSTVQFHILGMKCKICESYNTAQAGGRRISLDQQ                       211 - 261
//

Text Mined References (57)

PMID Year Title