Property Summary

NCBI Gene PubMed Count 16
PubMed Score 18.84
PubTator Score 13.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.900 0.001
osteosarcoma -4.767 0.000
cystic fibrosis 1.221 0.000
medulloblastoma, large-cell -1.300 0.001
lung cancer -1.100 0.023
group 4 medulloblastoma -1.200 0.003
subependymal giant cell astrocytoma 1.214 0.046

Gene RIF (8)

PMID Text
25582271 Through molecular genotyping we also identified polymorphisms in RhCE, Kell, Duffy, Colton, Lutheran and Scianna loci in donors and patients.
24094239 the five known probands with the SC*994C>T silencing nucleotide change were from the Pacific Islands.
19856728 Observational study of genotype prevalence. (HuGE Navigator)
18426659 The human ermap gene plays an important role in differentiation and development of erythroid cells.
15783300 Observational study of genotype prevalence. (HuGE Navigator)
12393480 DNA sequencing demonstrates Scianna antigens including Rd are expressed by ERMAP.
11783959 A human cDNA and gene encoding for human ERMAP is cloned and characterized. The protein is sequenced and its expression analyzed.
11549310 ERMAP, a unique member of the B30.2 domain protein family, is expressed in erythroid cells in fetal liver, adult bone marrow, reticulocytes and in circulating erythroblasts in 8-12-week fetal cord blood.

AA Sequence

MEMASSAGSWLSGCLIPLVFLRLSVHVSGHAGDAGKFHVALLGGTAELLCPLSLWPGTVPKEVRWLRSPF      1 - 70
PQRSQAVHIFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLEDQGSYRCLIQVGNLSKEDTVI     71 - 140
LQVAAPSVGSLSPSAVALAVILPVLVLLIMVCLCLIWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHK    141 - 210
AVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRFDFVV    211 - 280
SILGSEYFTTGCHYWEVYVGDKTKWILGVCSESVSRKGKVTASPANGHWLLRQSRGNEYEALTSPQTSFR    281 - 350
LKEPPRCVGIFLDYEAGVISFYNVTNKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEE    351 - 420
SIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF                   421 - 475
//

Text Mined References (18)

PMID Year Title
25582271 2015 Erythrocyte genotyping for transfusion-dependent patients at the Azienda Universitaria Policlinico of Naples.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24094239 2013 SC*994C>T causes the Sc(null) phenotype in Pacific Islanders and successful transfusion of Sc3+ blood to a patient with anti-Sc3.
19856728 2009 The polymorphism nt 76 in exon 2 of SC is more frequent in whites than in blacks.
18426659 2008 [Expression of human ermap gene in umbilical cord blood mononuclear cells during differentiation and development towards erythroid lineage].
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16371048 2005 SCER and SCAN: two novel high-prevalence antigens in the Scianna blood group system.
15783300 2005 ABO, Rh, MNS, Duffy, Kidd,Yt, Scianna, and Colton blood group systems in indigenous Chinese.
15660834 2005 STAR: a novel high-prevalence antigen in the Scianna blood group system.
More...