Property Summary

NCBI Gene PubMed Count 16
PubMed Score 20.84
PubTator Score 13.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
cystic fibrosis 1.221 1.2e-05
group 4 medulloblastoma -1.200 2.9e-03
lung cancer -1.100 2.3e-02
medulloblastoma, large-cell -1.300 1.4e-03
osteosarcoma -4.767 4.4e-09
psoriasis -1.900 1.0e-03
subependymal giant cell astrocytoma 1.214 4.6e-02

Gene RIF (8)

AA Sequence

MEMASSAGSWLSGCLIPLVFLRLSVHVSGHAGDAGKFHVALLGGTAELLCPLSLWPGTVPKEVRWLRSPF      1 - 70
PQRSQAVHIFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLEDQGSYRCLIQVGNLSKEDTVI     71 - 140
LQVAAPSVGSLSPSAVALAVILPVLVLLIMVCLCLIWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHK    141 - 210
AVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRFDFVV    211 - 280
SILGSEYFTTGCHYWEVYVGDKTKWILGVCSESVSRKGKVTASPANGHWLLRQSRGNEYEALTSPQTSFR    281 - 350
LKEPPRCVGIFLDYEAGVISFYNVTNKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEE    351 - 420
SIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF                   421 - 475
//

Text Mined References (18)

PMID Year Title