Property Summary

NCBI Gene PubMed Count 24
Grant Count 8
Funding $1,243,332.08
PubMed Score 28.83
PubTator Score 24.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
medulloblastoma, large-cell 1.100 0.000
non-small cell lung cancer -3.623 0.000
lung adenocarcinoma -2.500 0.000
lung carcinoma -5.300 0.000
spina bifida -1.622 0.043
psoriasis -1.100 0.000

Gene RIF (19)

PMID Text
23934357 This meta-analysis suggests that SCGB3A2 polymorphism at positions -112G>A was associated with Graves' disease both in Chinese and Caucasian population.
21410962 This study documents the association between polymorphisms in UGRP1 and the common cold, suggesting a potential role in its pathogenesis.
21385388 Reduced production of UGRP1, which is likely due, at least in part, to a local cytokine environment, may contribute to the hyper-inflammation in chronic rhinosinusitis and correlates with response to surgery.
21170691 the SCGB3A2 -112G >A polymorphism may be considered as a likely marker linking susceptibility to allergy/asthma and Graves' disease
20843168 pattern of UGRP-1 concentration resembled that of Clara cell protein, both proteins occurring in high concentrations in amniotic fluid, sputum and BALF and in much lower concentrations in serum and urine
20466451 Results demonstrate that SCGB3A2 is a useful marker for diagnosis of pulmonary tumors both in mice and humans.
20210668 association was detected between SCGB3A2 and U.K. Caucasian Graves' disease subjects but the size of effect was smaller than that seen in the Oriental population (odds ratio = 1.28-1.73).
20210668 Observational study of gene-disease association. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19126779 SCGB3A2 gene may contribute to Graves' disease susceptibility.
More...

AA Sequence

MKLVTIFLLVTISLCSYSATAFLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKC      1 - 70
VNELGPEASEAVKKLLEALSHLV                                                    71 - 93
//

Text Mined References (25)

PMID Year Title
23934357 2014 The association of SCGB3A2 polymorphisms with the risk of Graves' disease: a meta-analysis.
22155607 2011 Update of the human secretoglobin (SCGB) gene superfamily and an example of 'evolutionary bloom' of androgen-binding protein genes within the mouse Scgb gene superfamily.
21410962 2011 Variation in Uteroglobin-Related Protein 1 (UGRP1) gene is associated with allergic rhinitis in Singapore Chinese.
21385388 2011 The cytokine-driven regulation of secretoglobins in normal human upper airway and their expression, particularly that of uteroglobin-related protein 1, in chronic rhinosinusitis.
21170691 2011 The -112G>A polymorphism of the secretoglobin 3A2 (SCGB3A2) gene encoding uteroglobin-related protein 1 (UGRP1) increases risk for the development of Graves' disease in subsets of patients with elevated levels of immunoglobulin E.
20843168 2010 Development of a new sensitive ELISA for the determination of uteroglobin-related protein 1, a new potential biomarker.
20466451 2011 Secretoglobin 3A2/uteroglobin-related protein 1 is a novel marker for pulmonary carcinoma in mice and humans.
20210668 2010 Confirmation of association of chromosome 5q31-33 with United Kingdom Caucasian Graves' disease.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19126779 2009 Functional SNPs in the SCGB3A2 promoter are associated with susceptibility to Graves' disease.
More...