Property Summary

NCBI Gene PubMed Count 28
Grant Count 16
Funding $1,971,148.93
PubMed Score 20.25
PubTator Score 23.94

Knowledge Summary

Patent

No data available

Gene RIF (20)

PMID Text
25972488 we provide evidence for involvement of HCK and FGR in FCRL4-mediated immunoregulation and for the functional importance of posttranslational modifications of the FCRL4 molecule.
25738996 Significantly increased FCRL4 mRNA only in Graves disease patients but not in Hashimoto patients compared to normal controls.
25012527 The observed significant gene-environment interaction suggests that drinking and cooking oil use with FCRL4 gene polymorphism has a significant interaction.
24162774 Data indicate that signaling by HIV-1 gp120 through integrin alpha4beta7 resulted in increased expression of the immunosuppressive cytokine TGF-beta1 and FcRL4.
24162774 Treatment of B cells with HIV-1 gp120 upregulates the expression of FCRL4 and limits the proliferative expansion of B cells in an integrin alpha 4/beta 7-dependent manner
24162774 Treatment of B cells with HIV-1 gp120 upregulates the expression of FCRL4 and limits the proliferative expansion of B cells in an integrin alpha 4/beta 7-dependent manner
23855758 IRTA1 and T-bet are positive markers for the diagnosis of nodal marginal zone lymphoma
22777505 The FCRL4 polymorphisms may play an important role in the susceptibility and severity of ankylosing spondylitis in the Chinese Han population.
22716304 The cytological features, growth pattern and IRTA1 positivity in nodal marginal zone lymphomas suggest they may derive from IRTA1(+) perifollicular B cells or monocytoid B cells detectable in reactive lymph nodes.
22491254 In cellular binding assays, as a bona fide receptor FcRL4 binds efficiently to immunoglobulin (Ig)A.
More...

AA Sequence

MLLWASLLAFAPVCGQSAAAHKPVISVHPPWTTFFKGERVTLTCNGFQFYATEKTTWYHRHYWGEKLTLT      1 - 70
PGNTLEVRESGLYRCQARGSPRSNPVRLLFSSDSLILQAPYSVFEGDTLVLRCHRRRKEKLTAVKYTWNG     71 - 140
NILSISNKSWDLLIPQASSNNNGNYRCIGYGDENDVFRSNFKIIKIQELFPHPELKATDSQPTEGNSVNL    141 - 210
SCETQLPPERSDTPLHFNFFRDGEVILSDWSTYPELQLPTVWRENSGSYWCGAETVRGNIHKHSPSLQIH    211 - 280
VQRIPVSGVLLETQPSGGQAVEGEMLVLVCSVAEGTGDTTFSWHREDMQESLGRKTQRSLRAELELPAIR    281 - 350
QSHAGGYYCTADNSYGPVQSMVLNVTVRETPGNRDGLVAAGATGGLLSALLLAVALLFHCWRRRKSGVGF    351 - 420
LGDETRLPPAPGPGESSHSICPAQVELQSLYVDVHPKKGDLVYSEIQTTQLGEEEEANTSRTLLEDKDVS    421 - 490
VVYSEVKTQHPDNSAGKISSKDEES                                                 491 - 515
//

Text Mined References (29)

PMID Year Title
25972488 2015 Involvement of the HCK and FGR src-family kinases in FCRL4-mediated immune regulation.
25738996 2015 Expression Profile of Human Fc Receptor-Like 1, 2, and 4 Molecules in Peripheral Blood Mononuclear Cells of Patients with Hashimoto's Thyroiditis and Graves' Disease.
25012527 2015 Case-only designs for exploring the interaction between FCRL4 gene and suspected environmental factors in patients with ankylosing spondylitis.
24162774 2013 The HIV-1 envelope protein gp120 impairs B cell proliferation by inducing TGF-?1 production and FcRL4 expression.
23855758 2013 Nodal reactive and neoplastic proliferation of monocytoid and marginal zone B cells: an immunoarchitectural and molecular study highlighting the relevance of IRTA1 and T-bet as positive markers.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22777505 2012 Association of FCRL4 polymorphisms on disease susceptibility and severity of ankylosing spondylitis in Chinese Han population.
22716304 2012 IRTA1 is selectively expressed in nodal and extranodal marginal zone lymphomas.
22491254 2012 Cutting edge: human FcRL4 and FcRL5 are receptors for IgA and IgG.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
More...