Property Summary

NCBI Gene PubMed Count 30
PubMed Score 23.63
PubTator Score 23.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 2.1e-07
osteosarcoma 7950 1.6e-04
primary Sjogren syndrome 735 1.1e-03
nasopharyngeal carcinoma 1058 4.6e-03
interstitial cystitis 2312 1.8e-02
psoriasis 6694 1.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Multiple myeloma 1332 0.0 5.0

Expression

  Differential Expression (6)

Disease log2 FC p
interstitial cystitis 1.900 1.8e-02
nasopharyngeal carcinoma -1.300 4.6e-03
osteosarcoma -1.044 1.6e-04
ovarian cancer -2.700 2.1e-07
primary Sjogren syndrome 1.300 1.1e-03
psoriasis 1.400 1.9e-02

Gene RIF (21)

AA Sequence

MLLWASLLAFAPVCGQSAAAHKPVISVHPPWTTFFKGERVTLTCNGFQFYATEKTTWYHRHYWGEKLTLT      1 - 70
PGNTLEVRESGLYRCQARGSPRSNPVRLLFSSDSLILQAPYSVFEGDTLVLRCHRRRKEKLTAVKYTWNG     71 - 140
NILSISNKSWDLLIPQASSNNNGNYRCIGYGDENDVFRSNFKIIKIQELFPHPELKATDSQPTEGNSVNL    141 - 210
SCETQLPPERSDTPLHFNFFRDGEVILSDWSTYPELQLPTVWRENSGSYWCGAETVRGNIHKHSPSLQIH    211 - 280
VQRIPVSGVLLETQPSGGQAVEGEMLVLVCSVAEGTGDTTFSWHREDMQESLGRKTQRSLRAELELPAIR    281 - 350
QSHAGGYYCTADNSYGPVQSMVLNVTVRETPGNRDGLVAAGATGGLLSALLLAVALLFHCWRRRKSGVGF    351 - 420
LGDETRLPPAPGPGESSHSICPAQVELQSLYVDVHPKKGDLVYSEIQTTQLGEEEEANTSRTLLEDKDVS    421 - 490
VVYSEVKTQHPDNSAGKISSKDEES                                                 491 - 515
//

Text Mined References (31)

PMID Year Title