Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.13
PubTator Score 3.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 7.7e-13
osteosarcoma 7950 1.0e-10
ovarian cancer 8520 1.0e-09
Atopic dermatitis 952 1.9e-05

Expression

  Differential Expression (4)

Disease log2 FC p
Atopic dermatitis -2.000 1.9e-05
osteosarcoma 3.242 1.0e-10
ovarian cancer 1.300 1.0e-09
psoriasis -1.400 7.7e-13

Gene RIF (1)

AA Sequence

MSSQQQQRQQQQCPPQRAQQQQVKQPCQPPPVKCQETCAPKTKDPCAPQVKKQCPPKGTIIPAQQKCPSA      1 - 70
QQASKSKQK                                                                  71 - 79
//

Text Mined References (6)

PMID Year Title