Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.13
PubTator Score 3.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Gene RIF (1)

PMID Text
18643845 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.

AA Sequence

MSSQQQQRQQQQCPPQRAQQQQVKQPCQPPPVKCQETCAPKTKDPCAPQVKKQCPPKGTIIPAQQKCPSA      1 - 70
QQASKSKQK                                                                  71 - 79
//

Text Mined References (6)

PMID Year Title
18643845 2009 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11719550 2001 SPRR4, a novel cornified envelope precursor: UV-dependent epidermal expression and selective incorporation into fragile envelopes.
11279051 2001 Structural organization and regulation of the small proline-rich family of cornified envelope precursors suggest a role in adaptive barrier function.