Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.57
PubTator Score 6.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (5)

PMID Text
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
15033915 DEFB118 may contribute to epididymal innate immunity and provide antimicrobial activity against microorganisms attacking sperm in the male and female reproductive tracts.

AA Sequence

MKLLLLALPMLVLLPQVIPAYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDHRRVPATSP      1 - 70
TPLSDSTPGIIDDILTVRFTTDYFEVSSKKDMVEESEAGRGTETSLPNVHHSS                      71 - 123
//

Text Mined References (13)

PMID Year Title
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
15755028 2005 [Expression and biology identification of the human epididymis-specific gene ESC42 in E. coli].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15033915 2004 The androgen-regulated epididymal sperm-binding protein, human beta-defensin 118 (DEFB118) (formerly ESC42), is an antimicrobial beta-defensin.
12600824 2003 ORFeome-based search of airway epithelial cell-specific novel human [beta]-defensin genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11854508 2002 Discovery of five conserved beta -defensin gene clusters using a computational search strategy.
More...