Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.50
PubTator Score 6.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 2.8e-08
osteosarcoma 7950 5.1e-06
psoriasis 6694 6.0e-04

Gene RIF (5)

AA Sequence

MKLLLLALPMLVLLPQVIPAYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDHRRVPATSP      1 - 70
TPLSDSTPGIIDDILTVRFTTDYFEVSSKKDMVEESEAGRGTETSLPNVHHSS                      71 - 123
//

Text Mined References (13)

PMID Year Title