Property Summary

NCBI Gene PubMed Count 170
PubMed Score 88.05
PubTator Score 42.52

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.100 1.1e-03
fibroadenoma 1.100 8.4e-03
group 4 medulloblastoma -1.100 2.2e-03
juvenile dermatomyositis -1.018 1.3e-07
medulloblastoma, large-cell -1.100 3.9e-04

Synonym

Accession Q96PG8
Symbols JFY1
PUMA
JFY-1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (151)

AA Sequence

MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARPPGALGSV      1 - 70
LRPLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAPRPAPGRSSALALAGGAAPGV     71 - 140
ARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRTVRAAETRGAAAAPPLTLEGPVQSHH    141 - 210
GTPALTQGPQSPRDGAQLGACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM                       211 - 261
//

Text Mined References (171)

PMID Year Title