Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 0.22

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MKAEATVIPSRCARGLPSWQVLSPVQPWQTSAPQNTTQPKLLAPHQHEKSQKKSSLLKELGAFHITIALL      1 - 70
HLVFGGYLASIVKNLHLVVLKSWYPFWGAASFLISGILAITMKTFSKTYLKMLCLMTNLISLFCVLSGLF     71 - 140
VISKDLFLESPFESPIWRMYPNSTVHIQRLELALLCFTVLELFLPVPTAVTAWRGDCPSAKNDDACLVPN    141 - 210
TPLHLKGLPVEPPPSYQSVIQGDAQHKQHQRLREVKQVAPDTWIVTDGAAIWTQTAN                 211 - 267
//

Text Mined References (7)

PMID Year Title