Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 0.22

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96PG2 B2RP45 Q96PG3
Symbols MS4A9
CD20L7

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MKAEATVIPSRCARGLPSWQVLSPVQPWQTSAPQNTTQPKLLAPHQHEKSQKKSSLLKELGAFHITIALL      1 - 70
HLVFGGYLASIVKNLHLVVLKSWYPFWGAASFLISGILAITMKTFSKTYLKMLCLMTNLISLFCVLSGLF     71 - 140
VISKDLFLESPFESPIWRMYPNSTVHIQRLELALLCFTVLELFLPVPTAVTAWRGDCPSAKNDDACLVPN    141 - 210
TPLHLKGLPVEPPPSYQSVIQGDAQHKQHQRLREVKQVAPDTWIVTDGAAIWTQTAN                 211 - 267
//

Text Mined References (7)

PMID Year Title