Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.60
PubTator Score 0.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Gene RIF (3)

PMID Text
26449541 We replicated the rs11136000 (CLU)- rs670139 (MS4A4E) interaction, demonstrated an association in APOE epsilon4 negative subjects, and reported evidence of a possible dominant effect for MS4A4E.
21460840 ABCA7 and the MS4A6A/MS4A4E gene cluster are new Alzheimer's disease susceptibility loci.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MTTMQGMEQTTPGAGPDVPQLGNIDVIHSYLCKGLQEKFFKRKPKVLGVVRILIALMSLSMGIIMMCVAF      1 - 70
SSYEEHPIFVYVAYTIWGSVMYPYQLQQELEQQKVWNYLKNLSWRIMGSYLCFGERSELKPL             71 - 132
//

Text Mined References (6)

PMID Year Title
26449541 2016 Interaction between variants in CLU and MS4A4E modulates Alzheimer's disease risk.
23118302 2012 Genome-wide association study evaluating lipoprotein-associated phospholipase A2 mass and activity at baseline and after rosuvastatin therapy.
21460840 2011 Common variants at ABCA7, MS4A6A/MS4A4E, EPHA1, CD33 and CD2AP are associated with Alzheimer's disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11486273 2001 Structural organization of the human MS4A gene cluster on Chromosome 11q12.