Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.73
PubTator Score 0.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (4)

AA Sequence

MTTMQGMEQTTPGAGPDVPQLGNIDVIHSYLCKGLQEKFFKRKPKVLGVVRILIALMSLSMGIIMMCVAF      1 - 70
SSYEEHPIFVYVAYTIWGSVMYPYQLQQELEQQKVWNYLKNLSWRIMGSYLCFGERSELKPL             71 - 132
//

Text Mined References (7)

PMID Year Title