Property Summary

NCBI Gene PubMed Count 11
PubMed Score 11.40
PubTator Score 13.85

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
Pick disease 1893 1.02246180874726E-4
ovarian cancer 8492 1.42533701824071E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 6.1044891391284E-4
adrenocortical carcinoma 1427 0.00376094293641749
Disease Target Count Z-score Confidence
Methylmalonic acidemia 39 5.4 2.7


  Differential Expression (4)

Disease log2 FC p
adrenocortical carcinoma -1.016 0.004
pancreatic ductal adenocarcinoma liver m... -2.589 0.001
Pick disease -1.100 0.000
ovarian cancer 1.300 0.000


Accession Q96PE7 Q53TP1 Q8WW63
Symbols GLOD2




  Ortholog (14)

Gene RIF (2)

20877624 Observational study of gene-disease association. (HuGE Navigator)
17823972 analysis of frequency of mutations in the methylmalonyl CoA epimerase gene (MCEE) in atypical methylmalonic aciduria

AA Sequence

KIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA                                      141 - 176

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17823972 2007 Atypical methylmalonic aciduria: frequency of mutations in the methylmalonyl CoA epimerase gene (MCEE).
16843692 Propionyl-CoA and adenosylcobalamin metabolism in Caenorhabditis elegans: evidence for a role of methylmalonyl-CoA epimerase in intermediary metabolism.
16752391 2006 A homozygous nonsense mutation in the methylmalonyl-CoA epimerase gene (MCEE) results in mild methylmalonic aciduria.
16697227 2006 Homozygous nonsense mutation in the MCEE gene and siRNA suppression of methylmalonyl-CoA epimerase expression: a novel cause of mild methylmalonic aciduria.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).