Property Summary

NCBI Gene PubMed Count 12
PubMed Score 14.26
PubTator Score 8.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.900 5.1e-03
astrocytic glioma -2.600 4.0e-03
Astrocytoma, Pilocytic -2.900 5.6e-07
atypical teratoid / rhabdoid tumor -1.700 1.8e-04
ependymoma -2.900 2.8e-03
glioblastoma -2.300 4.3e-06
group 3 medulloblastoma -3.600 3.9e-04
medulloblastoma, large-cell -1.600 1.1e-02
oligodendroglioma -2.300 4.7e-03
osteosarcoma 1.162 5.1e-06
Pick disease -2.200 1.8e-02
primitive neuroectodermal tumor -2.100 1.3e-03
progressive supranuclear palsy -1.600 3.9e-02
subependymal giant cell astrocytoma -4.662 3.8e-04

Gene RIF (1)

AA Sequence

MSFSLNFTLPANTTSSPVTGGKETDCGPSLGLAAGIPLLVATALLVALLFTLIHRRRSSIEAMEESDRPC      1 - 70
EISEIDDNPKISENPRRSPTHEKNTMGAQEAHIYVKTVAGSEEPVHDRYRPTIEMERRRGLWWLVPRLSL     71 - 140
E//

Text Mined References (15)

PMID Year Title