Property Summary

NCBI Gene PubMed Count 12
PubMed Score 14.07
PubTator Score 8.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.600 0.004
ependymoma -3.000 0.000
oligodendroglioma -2.700 0.000
glioblastoma multiforme -2.700 0.000
osteosarcoma 1.162 0.000
group 3 medulloblastoma -3.600 0.000
atypical teratoid/rhabdoid tumor -2.600 0.000
medulloblastoma, large-cell -1.600 0.011
primitive neuroectodermal tumor -2.100 0.001
pediatric high grade glioma -2.400 0.000
pilocytic astrocytoma -2.800 0.000
subependymal giant cell astrocytoma -4.662 0.000
Pick disease -2.200 0.018
progressive supranuclear palsy -1.600 0.039

Gene RIF (1)

PMID Text
18490449 highly sialylglycosylated Opalin has a role in an intermembranous function of the myelin paranodal loops in the central nervous system

AA Sequence

MSFSLNFTLPANTTSSPVTGGKETDCGPSLGLAAGIPLLVATALLVALLFTLIHRRRSSIEAMEESDRPC      1 - 70
EISEIDDNPKISENPRRSPTHEKNTMGAQEAHIYVKTVAGSEEPVHDRYRPTIEMERRRGLWWLVPRLSL     71 - 140
E//

Text Mined References (15)

PMID Year Title
18490449 2008 Opalin, a transmembrane sialylglycoprotein located in the central nervous system myelin paranodal loop membrane.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17442045 2007 An oligodendrocyte enhancer in a phylogenetically conserved intron region of the mammalian myelin gene Opalin.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...