Property Summary

NCBI Gene PubMed Count 16
PubMed Score 26.00
PubTator Score 17.03

Knowledge Summary

Patent (4,720)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
breast carcinoma 1614 6.14581998875454E-7
malignant mesothelioma 3163 1.0380995342975E-5
invasive ductal carcinoma 2950 1.19904169450782E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 1.43184543805524E-4
sonic hedgehog group medulloblastoma 1482 3.84644741476295E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.06102088685722E-4
lung cancer 4473 5.12112325742506E-4
atypical teratoid / rhabdoid tumor 4369 0.00103257161739542
psoriasis 6685 0.00231494044492921
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00279477978006054
non-inflammatory breast cancer 208 0.00458510166544406
medulloblastoma, large-cell 6234 0.00524579330379852
osteosarcoma 7933 0.00536971576834509
pancreatic cancer 2300 0.00596450574127784
ductal carcinoma in situ 1745 0.0111323635644722
primary pancreatic ductal adenocarcinoma 1271 0.0219823208871513
Disease Target Count Z-score Confidence
Arteriovenous malformation 8 3.364 1.7

Expression

Synonym

Accession Q96PE1 A6H8W3 D3DSW4 Q8N3R1 Q8TEM3 Q96KB2 Q9P1Z7 Q9UFY4
Symbols TEM5
GPR124

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Pig OMA EggNOG

  TechDev Info (2)

Gene RIF (4)

PMID Text
24582749 Observed an inverse correlation between the expression of miR-138-5p and GPR124 in lung adenocarcinoma specimens. Knockdown of GPR124 mimicked the effects of miR-138-5p on the sensitivity to gefitinib.
22013897 Thrombin-induced shedding of tumour endothelial marker 5 and exposure of its RGD motif are regulated by cell-surface protein disulfide-isomerase.
19853600 TEM5 expression during capillary morphogenesis is induced by the small GTPase Rac and mediates contact inhibition of proliferation in endothelial cells.
16982628 Proteolytically processed soluble tumor endothelial marker TEM5 mediates endothelial cell survival during angiogenesis by linking integrin alpha(v)beta3 to glycosaminoglycans

AA Sequence

MGAGGRRMRGAPARLLLPLLPWLLLLLAPEARGAPGCPLSIRSCKCSGERPKGLSGGVPGPARRRVVCSG      1 - 70
GDLPEPPEPGLLPNGTVTLLLSNNKITGLRNGSFLGLSLLEKLDLRNNIISTVQPGAFLGLGELKRLDLS     71 - 140
NNRIGCLTSETFQGLPRLLRLNISGNIFSSLQPGVFDELPALKVVDLGTEFLTCDCHLRWLLPWAQNRSL    141 - 210
QLSEHTLCAYPSALHAQALGSLQEAQLCCEGALELHTHHLIPSLRQVVFQGDRLPFQCSASYLGNDTRIR    211 - 280
WYHNRAPVEGDEQAGILLAESLIHDCTFITSELTLSHIGVWASGEWECTVSMAQGNASKKVEIVVLETSA    281 - 350
SYCPAERVANNRGDFRWPRTLAGITAYQSCLQYPFTSVPLGGGAPGTRASRRCDRAGRWEPGDYSHCLYT    351 - 420
NDITRVLYTFVLMPINASNALTLAHQLRVYTAEAASFSDMMDVVYVAQMIQKFLGYVDQIKELVEVMVDM    421 - 490
ASNLMLVDEHLLWLAQREDKACSRIVGALERIGGAALSPHAQHISVNARNVALEAYLIKPHSYVGLTCTA    491 - 560
FQRREGGVPGTRPGSPGQNPPPEPEPPADQQLRFRCTTGRPNVSLSSFHIKNSVALASIQLPPSLFSSLP    561 - 630
AALAPPVPPDCTLQLLVFRNGRLFHSHSNTSRPGAAGPGKRRGVATPVIFAGTSGCGVGNLTEPVAVSLR    631 - 700
HWAEGAEPVAAWWSQEGPGEAGGWTSEGCQLRSSQPNVSALHCQHLGNVAVLMELSAFPREVGGAGAGLH    701 - 770
PVVYPCTALLLLCLFATIITYILNHSSIRVSRKGWHMLLNLCFHIAMTSAVFAGGITLTNYQMVCQAVGI    771 - 840
TLHYSSLSTLLWMGVKARVLHKELTWRAPPPQEGDPALPTPSPMLRFYLIAGGIPLIICGITAAVNIHNY    841 - 910
RDHSPYCWLVWRPSLGAFYIPVALILLITWIYFLCAGLRLRGPLAQNPKAGNSRASLEAGEELRGSTRLR    911 - 980
GSGPLLSDSGSLLATGSARVGTPGPPEDGDSLYSPGVQLGALVTTHFLYLAMWACGALAVSQRWLPRVVC    981 - 1050
SCLYGVAASALGLFVFTHHCARRRDVRASWRACCPPASPAAPHAPPRALPAAAEDGSPVFGEGPPSLKSS   1051 - 1120
PSGSSGHPLALGPCKLTNLQLAQSQVCEAGAAAGGEGEPEPAGTRGNLAHRHPNNVHHGRRAHKSRAKGH   1121 - 1190
RAGEACGKNRLKALRGGAAGALELLSSESGSLHNSPTDSYLGSSRNSPGAGLQLEGEPMLTPSEGSDTSA   1191 - 1260
APLSEAGRAGQRRSASRDSLKGGGALEKESHRRSYPLNAASLNGAPKGGKYDDVTLMGAEVASGGCMKTG   1261 - 1330
LWKSETTV                                                                 1331 - 1338
//

Text Mined References (23)

PMID Year Title
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
24925318 2014 POMK mutations disrupt muscle development leading to a spectrum of neuromuscular presentations.
24582749 2014 miR-138-5p reverses gefitinib resistance in non-small cell lung cancer cells via negatively regulating G protein-coupled receptor 124.
24501278 2014 Exome sequencing identifies de novo gain of function missense mutation in KCND2 in identical twins with autism and seizures that slows potassium channel inactivation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
22013897 2012 Thrombin-induced shedding of tumour endothelial marker 5 and exposure of its RGD motif are regulated by cell-surface protein disulfide-isomerase.
21421844 2011 GPR124, an orphan G protein-coupled receptor, is required for CNS-specific vascularization and establishment of the blood-brain barrier.
19853600 2010 Tumor endothelial marker 5 expression in endothelial cells during capillary morphogenesis is induced by the small GTPase Rac and mediates contact inhibition of cell proliferation.
19448619 2009 Loci at chromosomes 13, 19 and 20 influence age at natural menopause.
More...