Property Summary

Ligand Count 11
NCBI Gene PubMed Count 37
PubMed Score 112.00
PubTator Score 44.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Astrocytoma, Pilocytic -1.100 6.2e-05
Atopic dermatitis -2.000 7.3e-05
breast carcinoma -2.000 1.0e-02
ductal carcinoma in situ -3.200 1.0e-03
fibroadenoma -2.700 4.3e-02
interstitial cystitis -1.300 6.0e-03
intraductal papillary-mucinous neoplasm ... 1.300 9.7e-03
invasive ductal carcinoma -3.800 1.4e-03
pancreatic ductal adenocarcinoma liver m... -1.343 6.8e-04
pituitary cancer 1.500 3.2e-04
primitive neuroectodermal tumor -1.300 4.6e-03
psoriasis -1.200 1.9e-42

Gene RIF (22)

AA Sequence

MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLNRSKVEKQLQV      1 - 70
ISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKGGRRSQWVRNWAVWRYFRDYF     71 - 140
PIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMS    141 - 210
GGICPVSRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFG    211 - 280
ENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHP    281 - 350
TQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN                                    351 - 388
//

Text Mined References (40)

PMID Year Title