Property Summary

NCBI Gene PubMed Count 33
Grant Count 30
R01 Count 20
Funding $3,194,373.9
PubMed Score 98.97
PubTator Score 44.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (18)

PMID Text
25244504 uPA/uPAR stimulates triglyceride synthesis in Huh7 hepatoma cells via p38-dependent upregulation of DGAT2
24820123 DGAT2 is regulated by gp78-associated endoplasmic-reticulum-associated degradation at the post-translational level.
23489367 Hepatic triacylglycerol synthesis and secretion: DGAT2 as the link between glycaemia and triglyceridaemia.
22748069 describe distinct but synergistic roles of the two DGATs in an integrated pathway of TAG synthesis and secretion, with DGAT2 acting upstream of DGAT1
22315393 Niacin treatment may reduce liver fat content in Chinese patients with dyslipidemia and the mechanism may involve inhibition of DGAT2.
20679960 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19049983 DGAT2, an ER-resident transmembrane domain-containing enzyme, is also found in mitochondria-associated membranes, where its N terminus may promote its association with mitochondria.
More...

AA Sequence

MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLNRSKVEKQLQV      1 - 70
ISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKGGRRSQWVRNWAVWRYFRDYF     71 - 140
PIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMS    141 - 210
GGICPVSRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFG    211 - 280
ENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHP    281 - 350
TQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN                                    351 - 388
//

Text Mined References (36)

PMID Year Title
26349027 2015 Discovery and Optimization of Imidazopyridine-Based Inhibitors of Diacylglycerol Acyltransferase 2 (DGAT2).
25813485 2015 Stress of endoplasmic reticulum modulates differentiation and lipogenesis of human adipocytes.
25792450 2015 Roles of Acyl-CoA:Diacylglycerol Acyltransferases 1 and 2 in Triacylglycerol Synthesis and Secretion in Primary Hepatocytes.
25244504 2014 Urokinase-type plasminogen activator (uPA) stimulates triglyceride synthesis in Huh7 hepatoma cells via p38-dependent upregulation of DGAT2.
24820123 2014 Regulation of diacylglycerol acyltransferase 2 protein stability by gp78-associated endoplasmic-reticulum-associated degradation.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23489367 2013 Hepatic triacylglycerol synthesis and secretion: DGAT2 as the link between glycaemia and triglyceridaemia.
22748069 2012 Diacylglycerol acyltransferase 2 acts upstream of diacylglycerol acyltransferase 1 and utilizes nascent diglycerides and de novo synthesized fatty acids in HepG2 cells.
22315393 2012 Liver fat reduction with niacin is influenced by DGAT-2 polymorphisms in hypertriglyceridemic patients.
21933415 2011 Evolutionary view of acyl-CoA diacylglycerol acyltransferase (DGAT), a key enzyme in neutral lipid biosynthesis.
More...